SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016253 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000016253
Domain Number - Region: 149-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000923
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016253   Gene: ENSORLG00000012970   Transcript: ENSORLT00000016254
Sequence length 369
Comment pep:novel chromosome:MEDAKA1:11:23038953:23073471:-1 gene:ENSORLG00000012970 transcript:ENSORLT00000016254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRDPETRSVSLLEQKRKVVSSSIDVPHTRRSEEEADMDKVTAAMVLTSLSTSPLVRSPP
VKVSGKDNGPAVPFTPSSNSSSGGYWSWSAPSDQSNPSTPSPPLSADSFKPFRVPRPEDP
SLDDQDGTSLLFDEPIPRKRKNSMKVMFKCLWKNCGKVLSTTAGIQRHIRTIHLGSDGEE
DFYYTEIKLNTDSVADGLSSLSPASPSVLSPPPPPPSPLPPLSQPPDSHRPPPPSNAKEP
HVGGTTPLSRSAPSALYLIHTDHAYQSSSNSADSASTSFTPTNSSGFSISWQSPPVTFTG
KTVSPSKSQGFGEQRSQTISVLSSPPRAATALRKVRGEGKKCRKVYGMENRDMWCTACRW
KKACQRFTD
Download sequence
Identical sequences H2MCG7
ENSORLP00000016253 ENSORLP00000016253 8090.ENSORLP00000016253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]