SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016263 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016263
Domain Number 1 Region: 294-459,869-1048
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.76e-122
Family Mammalian PLC 0.0000101
Further Details:      
 
Domain Number 2 Region: 617-731
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.00000601
Further Details:      
 
Domain Number 3 Region: 1065-1188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.96e-26
Family PLC-like (P variant) 0.0019
Further Details:      
 
Domain Number 4 Region: 515-616
Classification Level Classification E-value
Superfamily SH2 domain 8.08e-26
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 765-829
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-20
Family SH3-domain 0.0000694
Further Details:      
 
Domain Number 6 Region: 6-116
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 7 Region: 127-286
Classification Level Classification E-value
Superfamily EF-hand 0.000000000423
Family Calmodulin-like 0.047
Further Details:      
 
Domain Number 8 Region: 457-493
Classification Level Classification E-value
Superfamily PH domain-like 0.0000675
Family Pleckstrin-homology domain (PH domain) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016263   Gene: ENSORLG00000012975   Transcript: ENSORLT00000016264
Sequence length 1265
Comment pep:novel chromosome:MEDAKA1:4:23035730:23068617:1 gene:ENSORLG00000012975 transcript:ENSORLT00000016264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RILHTLEMGMGLTVFYQKKSQRPERRTFHIRQDTRQIVWCRNRDKIEGEVDIREIRELRL
GKGSRDFERYPEEARKLDPTLCFIVLYGVEFRLRTLCVAAYSEEEVNMWISGLNWMMMDT
KRAPAPQQIDRWLRKQFEVMDRSHEGSITVKEVKALLPQINYRVPNTRFLKDKLQEVEAR
SELSYPNFAQLYRTLMFDAQRSIIEQLDLSFPLRNVDRPELCQISLYDFQKFLQMDQKES
WASDLSRVREFLLGYMKGAPQPEPTLQLDEFLAFLFSKENSVCNPRLSPVNPDEMKRPLS
QYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPEDLPIIYHGHTLTSK
IKFLDVLHTIKEHAFVTSEYPVILSIEDHCSVVQQRNMATNFKKVFGDLLLTKPVDNNAD
ELPSPYQLRRKILIKHKKLVEGTLYEEVMSASYSENDISNSLKNGILYLEDPIDHTWTPH
YFVLTSNKIYYSEETSHYQTADEEEDDEGKEECNNNEQHCAERWFHGKLGGGRDGRQVAE
KLLQDYCEGGGKDGTFLVRESETFVGDYTLSFWRSGRVQHCRIHSRQESGSTRFYLTDNL
VFDSLYRLICHYRDTPLRCNEFEMRLGNPVPQPNAHESREWYHSSLSRVQAEHMLMRVPR
DGAFLVRKRSEHNSYAISFRAEGKIKHCRIQQEGRLFMLGSSAEFESLVDLVSYYEKHPL
YRKMRLRYPINEDTLDRMGTTELDYGALYEVRTPHFYVEANKMPTARECTVKALYDYRAQ
REDELCFPKQALILNVDKQEGGWWRGDYGGKKQLWFPANYVEEVPTSPTRELDEASSENS
PLGNLLKGFIDVPTCHVVVHKDGKNLRPFVFTIHSQNMSSHPVQTLDVAADTLEDLSSWV
GKIKEATQNADARMQEEKQMERRKKIAVELSDLVVYCRPVPFNEDKIGTERACYRDMSSF
PETKAEKFATRGRGKRFLQYNRRQLSRVYPRGQRLDSSNYDPLPMWLCGSQLVALNFQTP
DKPMQLNQALFMLGGGSGYVPQPDIMRDDAFDPFDKDTLHVEPITIQIQVLGARHLPKNG
RSIVCPFVEMEICGADYDCCKFKTDVVADNGLNPVWLQKQFVFDIHNPTFSFLRFTVYEE
DMFSDPNFLAQATYPVRLLRTGYRSVPLKNSYSEELELASLLVHIEIVNAKEEDDENLYT
SIQRLRDRTSELSTQVSLLERAGSADLSYQQSLEELRAAQDQLSELVEARNRRQVTKKLA
AKFYM
Download sequence
Identical sequences H2MCH7
8090.ENSORLP00000016263 ENSORLP00000016263 ENSORLP00000016263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]