SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016507 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016507
Domain Number 1 Region: 716-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000267
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 406-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000112
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 754-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000754
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016507   Gene: ENSORLG00000013169   Transcript: ENSORLT00000016508
Sequence length 808
Comment pep:known chromosome:MEDAKA1:1:32566938:32596301:1 gene:ENSORLG00000013169 transcript:ENSORLT00000016508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGKPQHLSKREFSPEPLSGVLPDEDSQDSLRLGAGEPLKGDQDLLTCGQCHSRFP
LSDILLFIEHKRRQCHGGPCVDKALDRPPSPSLASPLSTSSSHSQIQHPRRPRQPVEVAV
QVSLQDEDCLSAPLQGIIPKQENISESCCVWSGLSECRSMYLAAFMPAPYQLDILAPQQT
DKEEPSSYTCTTCKQPFTSAWFLLQHAQNTHGFRIYLESEPGSPLTPRMAAAPGMGGDCA
SSQPPLHAVQLADGSPYSLLRMPGSGSGRDSASTPREGRYPRTPPLFSPPPRHHLSPDDL
ALATHHPSAFDRVMRLNSVPLDPPQSMDFSRRLRELAGNASVGSPPLSPNKPSPMQRLLQ
PFQPGSKPPFTATPPLSTSQSPSGSRSTPNPASTLVQPGTPLKAKSCEFCGKTFKFQSNL
IVHRRSHTGEKPFKCHLCNHACTQASKLKRHMKTHCQNKSSALNAKSDDGLSAASSPEPG
TSELLASATDALKSVVSKFKSENNGLMPENDIENKPAAEKGGKNDYRFSLQLEGARHHQN
NEALHPHRRTTSQGPSDEGLGEADQADDGALTAVNGLGSLSNENLPRKLMGGRVSPDPLS
PLSKRIKVEKDLDPPITTIPNSENVYSQWLACYAASRQLKDPFVHFTGADSRQSPFASSS
EHSSENGSLRFSTPPGELDGERTASGRSGTGSGASTPHGGSGNGRPSSKDGRRSDTCEFC
GKVFKNCSNLTVHRRSHTGERPYKCELCSYACAQSSKLTRHMKTHGQMGKDVYKCEICHM
PFSVYSTLEKHMKKWHSERPLANDIKSE
Download sequence
Identical sequences H2MD67
8090.ENSORLP00000016507 ENSORLP00000016507 ENSORLP00000016507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]