SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016699 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016699
Domain Number 1 Region: 36-149
Classification Level Classification E-value
Superfamily POZ domain 2.04e-28
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 393-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000558
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 429-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000347
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016699   Gene: ENSORLG00000013322   Transcript: ENSORLT00000016700
Sequence length 521
Comment pep:novel chromosome:MEDAKA1:9:19321572:19323481:1 gene:ENSORLG00000013322 transcript:ENSORLT00000016700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FILESKIVKMFNSVKKAAIKLEKYIQEMDDGSYIEFDVPEFSNTVLTQLNELRLQGKLCD
IIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKSPEVFEQLLAFCYTGHMS
LQLKDIISFLTAASFLQMQAIIDKCTQILEGIHSKISLPVNVCSPGKETLKTSRNGVNDS
NLFINPTQISPPYYSRHLQAGPEARLEVTAKAQGRVRQNQEEAQSDRGSSDSVSEHDAAV
EVETEQVELIGKDGQVTDVHVKIEKVSRPTYSDSSSAGDDGYHTELVDGEQIVAVSVGSY
GPVIQPAAYSYSGLSSQCFVNLSNSSPTRSMLSGFRGGRARAKRPMAMPSSVLSHIKSGS
DDADSAVGPTGLENDVRERSLRSQWYPYNERLVCIYCGKTFNQKGSLDRHMRLHMGITPF
VCKFCGKKYTRKDQLEYHIRGHTDNKPFHCQICGKCFPFQGTLNQHLRKKHMGASEVNNH
MDSPERTEGESSCQKEPEDASEGMVFETQYAEEAPANDIEE
Download sequence
Identical sequences H2MDP8
ENSORLP00000016699 ENSORLP00000016699 8090.ENSORLP00000016699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]