SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016735 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016735
Domain Number 1 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 137-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 193-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 99-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 351-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016735   Gene: ENSORLG00000013352   Transcript: ENSORLT00000016736
Sequence length 407
Comment pep:novel chromosome:MEDAKA1:12:24756943:24758541:-1 gene:ENSORLG00000013352 transcript:ENSORLT00000016736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPEPAQSEEQQKEPDPSLIKEEQEEPEPPQIKEEQEEPEPPQIKEELEEPEPPQIKEKQE
ELISQDEAGNQHEESTSTTDKETDPQNRDQRKRRDRRKKTFSCKNCEKSFSYKSSLKKHK
TIHTGEKPFKCKDCDSSFNQISNLNTHMRTHTGEKPFSCKECDASFRQKNGLERHMRTHT
GEKPFTCIECDTSFSDAYNLKTHMMSHTGLKPFSCKECDKSFSQKSNLKTHMRTHTGEKP
FTCIECDTSFSDAYNLKTHMMSHTGQKPFSCKECDKGFSHRSSLKTHMRTHTGEKPYSCK
ECDKIFSVKSHLKTHMRTHTGEKPFSCKECDKSFSRNSNLKIHMRTHTGEKPFFCKECAK
SFSHLSHLKTHMITHTGEKPFPCDKCDASFSRIPTLKTHMKTHSGTH
Download sequence
Identical sequences H2MDT4
ENSORLP00000016735 ENSORLP00000016735 8090.ENSORLP00000016735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]