SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016758 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016758
Domain Number 1 Region: 201-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000185
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 176-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000292
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016758   Gene: ENSORLG00000013367   Transcript: ENSORLT00000016759
Sequence length 239
Comment pep:known chromosome:MEDAKA1:12:24888103:24890254:-1 gene:ENSORLG00000013367 transcript:ENSORLT00000016759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPNIMSSLETFQSQLGSVMERLAGAAVAELGRLLKQSSADVWTGPAAAPAPAAGSEESR
REDESFRQSFQKITDRFASLMEVWTKDAVESILKMLKASKCQVSLAEQSKGLNMRRKRRS
RTVQERVSSRRTAAVSAQTDCGSTSAAETTPPDSGEGETVPEDSEVTGQEKRAVGRFQCP
TCDKTFALKCLMNRHFLIHSRPHLCSQCGKRFAALRGLTAHSRTHTGQKLHRCAQCGTG
Download sequence
Identical sequences H2MDV6
ENSORLP00000016758 ENSORLP00000016758 8090.ENSORLP00000016758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]