SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016970 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016970
Domain Number 1 Region: 55-271
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-56
Family DBL homology domain (DH-domain) 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016970   Gene: ENSORLG00000013538   Transcript: ENSORLT00000016971
Sequence length 276
Comment pep:novel chromosome:MEDAKA1:16:18651140:18654694:1 gene:ENSORLG00000013538 transcript:ENSORLT00000016971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLPHSDTVKRRRLKFISFEGPILAPDGPCHSPTISIPSLEEIDPRLQELEQDPPNWRDV
APRDAIKKLSKKEAKRQEVINELFATEHAHVRMLSVLQTVFSKPLGRELLLTADELETIF
PSLDEIIELHYNFYENLKKLRLEDNYIVKNISTTVLHLFGGPEGEWFQKLTARFCSHQKY
SLEQIKAKRKDPRFNSFILEAESKPQCRRLQLKDIIPTVMQRLTKYPLLLENIAKNTDNS
NEKERVEKSAECCKRILNHVNDEVKKMENLLVSSMH
Download sequence
Identical sequences H2MEG4
ENSORLP00000016970 8090.ENSORLP00000016970 ENSORLP00000016970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]