SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017125 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017125
Domain Number 1 Region: 44-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 106-157
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000051
Family Hairy Orange domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017125   Gene: ENSORLG00000013651   Transcript: ENSORLT00000017126
Sequence length 319
Comment pep:novel chromosome:MEDAKA1:11:26230405:26233508:-1 gene:ENSORLG00000013651 transcript:ENSORLT00000017126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPHDYSSPDSDTDEFIDVGQEDSYCPVSGSMSPSSASQILARKKRRGIIEKRRRDRIN
HSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAIGGKGYFDTRALAVDYRTLG
FRECVGEVVRYLSSLEGESPDPIGARLVSHLSHCASELDPLLLQCPAASAMQFPSWPWAA
FPQITPPSTASPSPPFPSSRRDLALLGSYPPPTTLRLAPLAACQQVGPTLLPPTALASIH
RVPSLSASPGLTQSRQTQSSPHSTSSALPPPSSSSPATSSTPQVSFRPFAPLGSPTPQRR
GLSSSCKPGSGWGTEIGAF
Download sequence
Identical sequences H2MEW1
ENSORLP00000017125 8090.ENSORLP00000017125 ENSORLP00000017125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]