SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017146 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017146
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily POZ domain 1.39e-31
Family BTB/POZ domain 0.00091
Further Details:      
 
Domain Number 2 Region: 343-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000223
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017146
Domain Number - Region: 273-430
Classification Level Classification E-value
Superfamily FdhE-like 0.0119
Family FdhE-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017146   Gene: ENSORLG00000013669   Transcript: ENSORLT00000017147
Sequence length 469
Comment pep:novel chromosome:MEDAKA1:11:26249650:26255960:1 gene:ENSORLG00000013669 transcript:ENSORLT00000017147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPCYLPKLLFELNEQRKRGFFCDCSILVEGQVFKAHRNVLFAGSGYFRALLVHYLQDS
GQRYSTASLDIVTADAFSIILDFLYSGRLALNRSNVIEVMSAASYLQMTDLVNLCKDYIH
SSLEICSKEKEMTTAKDTRVQEGAMGPADSGTPAVTVPSDAGDAESLSQTAEGDRGSGLA
SESMTSTRTPLTVTVTSPPGSSRASSSSALTPELVNPKIEYDPDEGLMESPDNKLLTPYQ
GPSPHNTHHGRLLPSSPSHSNERSLAGYSSSFNARQLMEMLSRAEGPAALGDRATQRFTQ
ALGSGAAGSRMEETLGFVGSSIMEIQTDWLGEDTGDGLVVPVKLHKCPFCPYTAKQKGIM
KRHIRCHTGERPFPCPMCGKRFTRQEHLRTHALTVHRHYWPVTCKSCRRTFTGSGVSPGL
RRFGICESCNCVTTTHEDSAPVHPSSQQENMERADSGTDWSSFMDDVDE
Download sequence
Identical sequences H2MEY2
8090.ENSORLP00000017146 ENSORLP00000017146 ENSORLP00000017146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]