SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017158 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017158
Domain Number 1 Region: 91-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000103
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 53-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000161
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 901-952
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000517
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 737-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000209
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 5 Region: 649-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000016
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 416-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000009
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 1187-1237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000948
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 8 Region: 222-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000268
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017158
Domain Number - Region: 589-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 704-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000418
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 1155-1197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000435
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 181-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000538
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 851-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000823
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 335-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00608
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 135-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0366
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Domain Number - Region: 1111-1147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0457
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017158   Gene: ENSORLG00000013673   Transcript: ENSORLT00000017159
Sequence length 1275
Comment pep:novel chromosome:MEDAKA1:6:20950961:21032705:-1 gene:ENSORLG00000013673 transcript:ENSORLT00000017159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSSDGDDDPTGLSWVPSSPSSKDVASPSQMPDGCCDLGTATGGEEEGGAGLPYPCQFCD
KSFSRLSYLKRHEQIHSDKLPFKCTFCSRLFKHKRSRDRHVKLHTGDKKYSCQECEAAFS
RSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHSKNREHLALRSEREGGKKGG
EADLDQDLYMCDYCEETFSQTDELEKHVLTRHPQLSDRADLQCIHCPEIFLDEASLLTHI
ETQHANRKHKCPVCSEQFPSVEDVYCHLDSHRQPDSSIHSAASPDPALGSVASMSSATPD
SSASLERGSTPDSTLKHSQGSERGRRRGRSWGKVTYSCPYCSKRDFHSLAVLEIHLKTIH
ADKPQQSHTCQLCLETLPTLYNLNEHVRKAHRASGGSAGAAAAAFPLMQFSNVTAFHCNY
CPDMFGDINSLQEHIRVSHCLTGGIMAGSTTLEGNHAFFCNQCSMGFLTESSLTEHIQQT
HCTSATGGSTASGGGVAKLESPVLQAASQSFMEVYSCPYCTNSPIFGSLLKLTKHIKENH
KNIPLANNKRQAKVADLSPASSDVEISSPKRHRLGGGDSTPSMGSNGDYPCNQCDLRFGS
FETFQAHLKSHLEMLLRRQSCPQCSKEDFESQDALLQHLTVHYTTTSTQYVCESCDKQFS
SVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKLFRCTACAWDFRKE
ADLQLHVKHNHLGQRLKPRKCIFCGETFGTEVELQCHITTHSKKFTCRFCGKAFHAISLL
ERHLREKHCIFDGGITGNGGGGVERAKVAAAEQADLQNILKGGIVGGGSVQGGDTANSHE
ASGGEEELDNSEPMYACDICGAAYTMESLLQNHRLRDHNIRPGEDDAGSRKKKADFIKGN
HKCNVCSRTFFSENGLREHAQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGT
CRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLSTG
SALGAGGVGGGNGSASSSPNGQLQQHKLYKCAFCLKEFKNKGELVKLDVNGLPYGLCATC
MSRGTNGQSPSQGGAVTPGDMQAEKVASGLRCPECGVKFETPEDLESHVQTDHPEVSPET
STVAKKAEASPVPKKKTYQCIKCQMTFETEREIQIHVANHMIEEGINHECKLCNQMFDSP
AKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFF
QTELQQRHVTRQRAR
Download sequence
Identical sequences H2MEZ2
ENSORLP00000017158 ENSORLP00000017158 8090.ENSORLP00000017158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]