SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017202 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017202
Domain Number 1 Region: 293-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000007
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 326-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000146
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017202   Gene: ENSORLG00000013713   Transcript: ENSORLT00000017203
Sequence length 362
Comment pep:novel chromosome:MEDAKA1:1:33523369:33525714:1 gene:ENSORLG00000013713 transcript:ENSORLT00000017203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTQAGLPSFSSFSSLSYSREEMKVWRSEDSQTLDSAKRSAGSSGQAQLCQQMTEELAE
DDSQAAWDIEFLLSEWNTSSPELNPPLNSLQLTQAEANMAFAEVSPFKEQAGVESLQVNS
EGLRAELLSSSGPSTVHPELYQHGYEDQAGQTTFPVMHNVNPFDFPQGGSLQRPSRESFS
KVTSWDFNSYYSQQPVSIVTIPDNRFIPPQAVNPDLQHYGYTAHFNPNAALFRDYAHSQA
SLHLPHQQQPLLVRPPLPPGGMEGKRGRRSTGKKRPAIHSCDYPGCTKTYTKSSHLKAHL
RTHTGEKPYHCSWEGCSWKFARSDELTRHFRKHTGQKPYECLLCQRAFSRSDHLALHMKR
HT
Download sequence
Identical sequences H2MF32
ENSORLP00000017202 8090.ENSORLP00000017202 XP_004066255.2.28442 ENSORLP00000017202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]