SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017308 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017308
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.65e-17
Family MBT repeat 0.0076
Further Details:      
 
Domain Number 2 Region: 610-669
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000131
Family PHD domain 0.0059
Further Details:      
 
Domain Number 3 Region: 87-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000023
Family Tudor domain 0.017
Further Details:      
 
Domain Number 4 Region: 416-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000525
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017308   Gene: ENSORLG00000013802   Transcript: ENSORLT00000017309
Sequence length 998
Comment pep:novel chromosome:MEDAKA1:5:26776970:26787771:1 gene:ENSORLG00000013802 transcript:ENSORLT00000017309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTPPNRRGITFEVGAQLEARDSLKNWYAANIEKIDYEDEKVLIHYRQWSHRYDEWFDW
TSPYLRPVERIKLRKQGLYDGSSSHGFQVNDKVLASWSDCRFYPAKVISVNKDATYTVKF
YDGVIQTVKEMHVKPFVKERGGVGGKSRSSERSTVRRAPSRRDRRPQENGGPKNKRVRRS
TSDQEEDSNSDDEGREQEVENDKSSKTNDELQAAHTVKQEEESSDEEGHSRPGDEEKLTG
LTNGVKVEKGEDLNKGTGQLNGDLKKEDLENEKTGIKPYRQCAKPYTETPGQNPPRAEQA
SATKTSAECNGSVEQKPNVQLENPQTLANAPPPQPVKHNQKWIDKSRIFECIQFLNVGIF
LRLLSLFCVAVRKQGFHNPNRFSREPCEYSLSHCFCSLFSVYRVIKNQPPLVLSVNLDHN
PFKCSAPGCTKSFRKAKLLHYHMKYYHGEEQPMEGKHSPTRSVQTRASEKHTAAVPLDAS
KRRRTISASMRSVKDKTKEKPKQKDFLRIKQAKSDHTGSEENIDISVLGLHSKLNLQLKP
PLSHNHKPEAYPSRPGHSFSEQIHVDDSVHHEGMVPVDEDSISDWSTDSCGWSDDDFDMD
LDVTTPPLSTDSGAVDTNDQEIVRCICEVEEENDFMIQCEDCLCWQHGTCMGLLEDNVPD
RYTCYICRDPPGQRQSLRYWYDRDWLTNGHMYGFSFLEENYSHQNAMKITTTHQLLGDVH
HVVEVLNGLQLKMSILQNNPDPDLHLWRQPWKHLERSRTGPDCYKDGSIVPSPVTPSEDM
SRGEILMSNALEKLSRAATAATSSSSSSYSPFPSFQDSYINSDHCYQKPRAYYPAVEQRL
VVETRQGSELEDSLRSTEELLEREQCYGSLLEMEKPKKTGISNKASSPTVQKHASMGVGL
WSQAEKEDGRNSAETGDIKQLQQWQMNLLDHIDAVQEEVSHRMDFIERELDVLESWLDYT
GELEPPDPLARLPQLKQRIKRLLLQLGKVQQIALYSST
Download sequence
Identical sequences H2MFD6
8090.ENSORLP00000017308 ENSORLP00000017308 ENSORLP00000017308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]