SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017331 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017331
Domain Number 1 Region: 46-114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-19
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 2 Region: 168-228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 3 Region: 226-298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 4 Region: 103-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000459
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 4-56
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000567
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017331   Gene: ENSORLG00000013824   Transcript: ENSORLT00000017332
Sequence length 306
Comment pep:novel chromosome:MEDAKA1:1:33681133:33689072:-1 gene:ENSORLG00000013824 transcript:ENSORLT00000017332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRHFSPGVAIALSCKQGYTPVSGPRRIVCTIDGMWTKTRYMCIPKRCPYPDPPSNGELHY
EDTVYLSTINYTCNEGYTMDGSSTAVCQANGTWSTPAPECKAVSCGLAPIPQFGMIIYDK
MVRGNQTYFGIGGTYRCLPPLALFGNPRAECTINGTWTETPECRVVTCPPPENIEKGYMS
NEDRRDFDFRESVKYGCEGDYVLEGNMEIVCQQNGNWSEMPSCKAPCPVGIQGVKIQYRG
EKMWIADLKTKAILHKEILSVYCKDTVRNCSYAVPVQCLDGGLRLPECFEGKTPYLYYDG
SKKSST
Download sequence
Identical sequences H2MFF9
ENSORLP00000017331 8090.ENSORLP00000017331 ENSORLP00000017331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]