SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017336 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017336
Domain Number 1 Region: 1190-1242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 517-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000023
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 1065-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000361
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 766-817
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000048
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 803-852
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000657
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017336   Gene: ENSORLG00000013827   Transcript: ENSORLT00000017337
Sequence length 1382
Comment pep:novel chromosome:MEDAKA1:3:29316967:29326724:1 gene:ENSORLG00000013827 transcript:ENSORLT00000017337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHFQSDPHLPLSEHNAHPCVNMHICAFFVLCLILNGSVTHPFCTDRRSRNN
LNEKQCLEKVPLRVQIPATLQSEDLKAEVENKFKLIFSHQKGDTELCSEEPPCKESDAHV
CSRCCAEFFELSDFEEHKKNCTKNQLVLIVNENPISPAGTFSPGSSPQNADDQVNDTAAD
QTECNDLLDPNTLEKEESMDVDVSGMSSGHEEEGSQTERRSPISVPVSHAVRSTAGPAVG
TSAISAPLTQLSNLTELGNFSMINSNVIIENLQSTKVAVAQFSQEARSTGGPRVPVPALM
EQLLALQQQQIHQLQLIEQIRHQILLLASQSPELQVPPTSAPGTLGPAASPLTTLSSHLS
QQLAAAAGLAQNLASQSASISSLKQLAAAAQLPQSNPSSSETSQSITTLGPSTVNPQPSE
SRPTVMSSLHSQLSNSSAVKSSTPAFGIGSLLSSAVNPLLPQPPPGNSLFSSSLPSVGTT
VEDLNSLAALAQQRKGKPPNVTSFEHKSSSDDAFFKHKCRFCGKVFGSDSALQIHLRSHT
GERPYKCNVCGNRFSTRGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSM
PPEKPVTSWLDSKPVLPTLTSSVGMLLPPTMPSLPHFIKKEDHSIAITSPPVTAKNDSGA
AEPSAKSTDGAGEEGEGATLPTSNGKTEDGSHPSGLMTNVSSASEGIAEYTTSNSPPMMT
NPLMPLLTDQFKAKFPFGGILDPLQGSETSKLQQLVENIDRKVTDPNECVICHRVLSCQS
ALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAV
VLQQHIRMHMGGQIPNTPLPESYAESMASDTGSFDERNFDDMDNFSDDNIEGMEEGPDSS
VPDTPRSADASHDSLCNSPAPPEMAHNEGPEKNGKENIQNNEMEEYPVSQMKALANGLVE
GDCLTNDSSSLGGDVESQSAGSPAVSESTSSMQAPSPTSMQQQLRKSPSLEERQHRILSF
DHTSASLLQSHPCNIGALDLTSVNPSKEPLGMIFPFRERNTIKNTSCDICGKTFACQSAL
DIHYRSHTKERPFICTACNRGFSTKGNLKQHMLTHQMRDLPSQLFEPSNTSLSSSPTPSL
MSVSSLNKPEVNGFLHSLHPENKDLPPSLVTSSASTSPVLSAAPPRRTPKQHFCNTCGKC
FSSSSALQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSAPARRGRRLSVDGP
MAFLGTNPVKFPEIFQKDMAPRASNGDPASFWNQYAAAFSNGLAMKTNEISVIQNGGIPP
MSGGLGNGGSSPLGGLTGSLDKLHSTEPNAALAGLEKMANTENGGHFRFTRFMEDNKEIV
TN
Download sequence
Identical sequences H2MFG4
ENSORLP00000017336 ENSORLP00000017336 8090.ENSORLP00000017336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]