SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017362 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017362
Domain Number 1 Region: 44-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 214-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 158-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 269-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 100-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.45e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017362   Gene: ENSORLG00000013850   Transcript: ENSORLT00000017363
Sequence length 320
Comment pep:novel chromosome:MEDAKA1:21:14932540:14935781:1 gene:ENSORLG00000013850 transcript:ENSORLT00000017363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHTGEKPFSCKECGKCFTLSCSLTDHMRIHTGEKPFPCKECGRSFRRSSKLSVHMRIHTG
EKPFTCEECGRSFSHANSLTTHMRIHTGEKPFSCEECGRSFSQATSLTSHMRIHTGEKPF
SCEECGRSFSHANSLTYHMRIHTEEKKDFKCEECGRCFTHSGSLSVHMKIHTGEKPFSCK
ECGRSFSRVDSLISHMRIHTGEKPFSCKECGKCFTLSCSLTDHMRIHTGEKPFPCKECGR
SFRRSSKLSVHMRIHTGEKPFTCEECGRSFSHANSLTTHMRIHTGEKPFSCEECGRSFSQ
ATSLTSHMRIHTGEKPFSCE
Download sequence
Identical sequences H2MFI8
ENSORLP00000017362 8090.ENSORLP00000017362 ENSORLP00000017362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]