SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017376 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017376
Domain Number 1 Region: 192-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000486
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017376   Gene: ENSORLG00000013861   Transcript: ENSORLT00000017377
Sequence length 252
Comment pep:novel chromosome:MEDAKA1:5:26867978:26870039:-1 gene:ENSORLG00000013861 transcript:ENSORLT00000017377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKYFAKQKPNYSELECQNDSSPKRYPVAELSSADGSATCFTTGLLWDLSVIPA
LYLPTSESELSATSAPLDLSSPCSLSSSASSSGEEDEGRSSDPPSPEPVHTYTPRQRMNQ
QVILSSLEHDNQSEELYSQSVDIITQVLSPHHHHTAMCFFIIFSMCMHVCEVLMGSLCED
PMLIFFFIHFCTGERPFSCPHCNRAFADRSNLRAHLQTHAEVKKYQCGVCSRTFSRMSLL
QKHSSSGCCSTS
Download sequence
Identical sequences H2MFK2
ENSORLP00000017376 ENSORLP00000017376 8090.ENSORLP00000017376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]