SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017377 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017377
Domain Number 1 Region: 180-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 123-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 68-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 225-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 448-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 29-81
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000686
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017377   Gene: ENSORLG00000013863   Transcript: ENSORLT00000017378
Sequence length 506
Comment pep:novel chromosome:MEDAKA1:21:14967897:15032151:1 gene:ENSORLG00000013863 transcript:ENSORLT00000017378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGKPCGPGTTQKRGAFFHVGVHTLTKKVKEHCCEECEKSFTTAYQLRRHMRIHTGENLFS
CEECGRCFTRSGSLSVHMKIHTGEKPFSCKECGRSFSRSDSLTDHMRIHTGERSFFCEEC
GKSFTRIGKLSLHMRIHTGEKPFFCKECGRSFSRADSLIDHMRIHTGEKPFSCKVCGKCF
TLSCSLTDHMRIHTGEKPFPCKECGRSFRRSSKLSVHMRIHTGEKPFSCEECGKSFSHAN
SLTIHMRIHTGEKPFSCEKCGRSFSQATSLTNHMRIHTEERRINNRQVKKHFKKKRLMEK
HCRTKTVKKHCCEECEKSFTTPYCLRRHMRSHTREKALSCKECGKSFFYTKGLTSHMRTH
TGEKPFSCKECGKSFFYAKGLTSHMKTHTGEKPFSCKECGRTFSQASYLKSHMMTHTGEK
PFSCKECGRSFSRANTLKGHMRIHTGEKPFSCKECGRTFSQVSYLKSHMRIHTGEKPFPC
KECGRTFSRRDSLTKHMTIHTREKAF
Download sequence
Identical sequences H2MFK3
ENSORLP00000017377 ENSORLP00000017377 8090.ENSORLP00000017377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]