SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017378 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017378
Domain Number 1 Region: 156-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000208
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 
Domain Number 2 Region: 79-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000402
Family HkH motif-containing C2H2 finger 0.01
Further Details:      
 
Domain Number 3 Region: 210-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family HkH motif-containing C2H2 finger 0.068
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000112
Family HkH motif-containing C2H2 finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017378   Gene: ENSORLG00000013862   Transcript: ENSORLT00000017379
Sequence length 405
Comment pep:known chromosome:MEDAKA1:14:28179226:28183858:1 gene:ENSORLG00000013862 transcript:ENSORLT00000017379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDSDNFLCLSPEIVKAHKAILQNEDLFSPSFCKVCSAVLHSNKQRWSHYMGRKHANK
VRQYTSLQNEKELLHKKQKTSESDESNGDLDRTKACQLCNTIFTSKAVAESHYQGKFHAK
RLKMEMTDVQPAGRASTAEEPKEKPGGVIATVKTKDDNPERFCSICDASFNNPLMAEQHY
VGRKHKKRMTRVKLMETYGFSSAQAPTLLSFKCVLCNIEVNSISQYQSHLSGAKHRNQMK
KSGVKNTTENQQSAEEMQGGSKPRDDQKTPADDEYTPADDEYTPAEYTPADDEYTPADDE
YTPADDEYTPADDEYTPADDKCTPADDEYTPADDKYTPADDHNTTADDQYKPAGDQYSFA
VDRYTPADDRYTPADDHYTLGDDKYTAAGGQYTSTVDRYTPADDQ
Download sequence
Identical sequences H2MFK4
8090.ENSORLP00000017378 ENSORLP00000017378 ENSORLP00000017378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]