SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017457 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017457
Domain Number 1 Region: 96-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000214
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 280-334
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000813
Family Homeodomain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017457
Domain Number - Region: 65-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.075
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017457   Gene: ENSORLG00000013922   Transcript: ENSORLT00000017458
Sequence length 344
Comment pep:novel chromosome:MEDAKA1:5:26901380:26902411:-1 gene:ENSORLG00000013922 transcript:ENSORLT00000017458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTVPCMIPSKSKHLREEIILGSLPELLPTIPEDSILSISGEETSHVSSSSRSES
GSETQKGGTYSCVTCRFESRDLNYFLDHMHNCHLDFRAQPTFYCLNCRVSVVRFEALALH
NANSHPKIMEGLITASLSVNKRDGVTTVEQSLFTDSGEDYRESGISLTKTPIAKMMKGKG
EHKKIVISHTVEVLKIDMGKDVDTNVPELQNGALSFSGAPAMPRNAVNHVVTSTAPDQIF
HQHSPSLYSSLSSDSIKDLPKVMIPLSSIPTYDAAMDTSSFLKTSFGKFPYPTKAELCYL
TVVSEFPEEQIKLWFTAQRLKQGISWSPEEIEEARRKMFNTVFQ
Download sequence
Identical sequences H2MFT0
ENSORLP00000017457 ENSORLP00000017457 8090.ENSORLP00000017457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]