SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017481 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017481
Domain Number 1 Region: 34-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000504
Family HkH motif-containing C2H2 finger 0.037
Further Details:      
 
Domain Number 2 Region: 275-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000222
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number 3 Region: 202-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family HkH motif-containing C2H2 finger 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017481   Gene: ENSORLG00000013941   Transcript: ENSORLT00000017482
Sequence length 413
Comment pep:novel chromosome:MEDAKA1:16:19180165:19189137:-1 gene:ENSORLG00000013941 transcript:ENSORLT00000017482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FALGALPQKQVHPLLSALPLPGRALQPQSQLEHFLPLRVNGSSPLSLFPNFNTMDPIQKA
VINHTFGLAQPKRKPIISCNICHLRFNSTIQAEAHYKGHKHARKLKALETQRTRQKNGRS
QSTTGRAVMSGASPTSQASPTDSLLPTSPPSPQVAPSSQLCDGPSDGPQAEGCSPTTSAG
LQSDALQNCMGDEDAADQVEKVKEAKSNKKHIHCPTCKVTVNSSSQLEAHCSGSKHRQML
SGQRNCQSNRRFKMPLSPRPKCRIKHRPGSKGRAVVGVTKQGFHCELCQVSVNSETQLKQ
HMNSRRHKERLAGKPVKTKFTPINKLYPNAFLAHDLYITKVALQKHLSKVLPAGLLSSPL
SPALCNMASGPLALRLPPGLPAIIQGPLISTALFRPAPGPLRATHTPVIFAPY
Download sequence
Identical sequences H2MFV4
ENSORLP00000017481 8090.ENSORLP00000017481 ENSORLP00000017481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]