SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017541 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017541
Domain Number 1 Region: 145-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000202
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 435-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000019
Family C2HC finger 0.016
Further Details:      
 
Domain Number 3 Region: 550-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000033
Family C2HC finger 0.023
Further Details:      
 
Domain Number 4 Region: 818-849
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000578
Family C2HC finger 0.019
Further Details:      
 
Domain Number 5 Region: 699-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000643
Family C2HC finger 0.035
Further Details:      
 
Domain Number 6 Region: 90-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family C2HC finger 0.021
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017541
Domain Number - Region: 182-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000878
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017541   Gene: ENSORLG00000013995   Transcript: ENSORLT00000017542
Sequence length 855
Comment pep:novel chromosome:MEDAKA1:6:21703856:21709342:1 gene:ENSORLG00000013995 transcript:ENSORLT00000017542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CWISRLPLTSDASAANCTIYSQSEELFCKVTAEIADGEKLLAFLSPPQRSSLVAQKQVKE
EPLYPAALCSEIQLLPQQAGMAAILATAVVNKDIFPCKDCGIWFRSERNLQAHLMYYCAS
RQKQPAAASSPPQDKPKESYPNERICPFPQCNKSCPSASSLEIHMRTHSGERPFVCLICL
SAFTTKANCERHLKVHTDILNGVCHGCGFVSTTRDILYSHLVTSHMVCQPGSRSEVYSPG
PGLPKLPLSTVCGHNSDSPAHLQQHVRTHLEVRVPAERSPTPRQSTPSSFEHPQPSPQER
EPLACRNMEVKENGDQEQEAKRKTKDEQTSTSSCQTSNSPKSPTTNVKAEPTSPTPGSSP
AHLGGAGTIVPGGTLFLPQYMFNPEVAILPQASEILAKMSEMVHSRLKQGQAVVQNNPAA
FFPSGATAATATATPPHKGATCFECDITFNNINNFYAHKRLYCSSRHQGEASGSAPTAPS
TAHSSESQSLSPQVGASSRAASASPAGSDVPTGMGKEGVSSSSEGEGVGGERASEDSQSP
VSASTEDPEDDPNKTFCEACNIRFSRHENYTVHKRFYCASRHDPTNHRSAHAAKATNSTS
FLPQPIRTRKRKKMYEIHMARTEALANAAAAAAAAAAATAAASAPSPSVLGLAVKQEMSP
GGAGISSPEGDGPIDLSKRPRLSEASRHSSGGGILPALPLSDYHKCTACSISFNSIENYL
AHKTYYTGSSLVVCPYCPNRPITCDLMEHFKTTHGLVVSVQLPKEAPPQPGAPSRSPSLS
PASITPTGLPKGTPRKTTPPAVSHPAPLPKTSVISPIQNGNSRFCRLCNIKFSSLSTFIA
HKKYYCSSHSAEHVK
Download sequence
Identical sequences H2MG13
ENSORLP00000017541 8090.ENSORLP00000017541 ENSORLP00000017541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]