SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017665 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017665
Domain Number 1 Region: 10-123
Classification Level Classification E-value
Superfamily POZ domain 6.48e-31
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 391-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000134
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 370-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000746
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017665   Gene: ENSORLG00000014087   Transcript: ENSORLT00000017666
Sequence length 514
Comment pep:novel chromosome:MEDAKA1:4:25905612:25907597:-1 gene:ENSORLG00000014087 transcript:ENSORLT00000017666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMERSGSIQLDIPDFSNSVLSHLNQLRVQGRLCDIVVNVQGQSFRAHKVVLAASSPYFRD
HMSLSQMSTVSLTVIRNPSVFEQLLTFCYTGRLCLQLADIISYLTAASFLQMQHIIDRCT
QILEGIHLKINLADLDDESRGEEVVRGSRRSTETVVRGGGHQGGLRLLGSRGGVEASEAG
SPTEEQLSPPPTVEHSGLEGPLTSSRVAKEPILRINRAGQWYVETSSEPERAGSAEEGGD
GIRIKTERMEEWIGAGDNQEDGVQMEEGATVMIDSSGRSTLVTGPLGALGARSAQPSSSF
SETDRFSPTGSVVVLTERQRAKSESPSRADELRQPSSQGEEHPAFDMGGYEEYLREQVGD
RWYRYNPRLTCIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRKHT
GNKPFHCHVCGKSFPFQAILNQHFRKNHPGCAPQEAHSASPETTTTSVTSRGGPSDEASP
SQEEPEGGGGGGGSSSGGQYGDGPQASVSTTGPD
Download sequence
Identical sequences H2MGC5
ENSORLP00000017660 8090.ENSORLP00000017660 ENSORLP00000017665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]