SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017714 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017714
Domain Number 1 Region: 45-161
Classification Level Classification E-value
Superfamily TPR-like 1.69e-19
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 852-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000869
Family Classic zinc finger, C2H2 0.075
Further Details:      
 
Domain Number 3 Region: 787-818
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000366
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017714
Domain Number - Region: 926-950
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0196
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 524-543
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 646-675
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0863
Family CCCH zinc finger 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017714   Gene: ENSORLG00000014127   Transcript: ENSORLT00000017715
Sequence length 987
Comment pep:novel chromosome:MEDAKA1:8:19340406:19358904:1 gene:ENSORLG00000014127 transcript:ENSORLT00000017715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARNMDPSREKRKEDIMKALAFIQEFYFPLTNPEGYQDYLTQLVCNLLEEGNAFFKDGLCD
QAAREFTEGLNVSSYAESEEIQIPVALQESLFVNRAAAYHSMGKYDESIADCNMALEVCK
ESRRALYRKALCLKELGRYREAYDCTSECLLSCPEDKQGKELAQELTVLLGLKTRKPYVS
TKVRPTLKPNSRALIATGRFLKKIPVPSSVTHTMNARPHCPPLFSIAARACTHTRGRAAP
THTHSSSTTVMNMGFPQPSFPPVCIHPGSSELLNRVAAVEDSELMDDDLDRLLDSVSTLH
GSSEVSEAAFSFPFRTSTSTHTLPPVLPAPTPQLPPAFFSSAISQLNSLDSFTNDEASYS
AAALDILDDLGSSSGDASSLLRTPKFNSLRTVLGLQIWFLMENLRLKSGDWPLQDLEKFM
KPVLCYPDSVFGIVVRKKAENFNPLSSTHEFLQACSTCFPREGVGIYTFVHKPDLVHNCK
RDVLLCRRKDAFSSEWTRVRRLPPKVSFSGPFVLCKEVLKSGDLGLCKYGENCTFAYNQL
EIDVWTEERKGTLDRNLLFGAEDGKLDPVNSIICLLRENKGMFIFLCQECYDNKPRIISR
RSSKKSTSCSNLDSPHNFSANKCLVFEVSKLNVNYNKVRPLSPLCHLDLCRPAIRYGCLR
EDDCLHAHSVIELKTWKIQRCTGISCDEIVKISKEFYEKQEQHSRAGRQSNGGGRDAKSL
NMRMKFVCALCLRGGLTSEPDKTLKYCKSKARHAWTKDRRVLLVMSSERSKWVQVRPLPH
TKNFPFYYDMCAQILEKRKCNYPGNCTFAHSQEEKEMWMYMKNNDLRDMQQVYDMWLALA
AQNRQAEEAPSYHPNYEEKCIIMPTDYADQLSGFHCRLCGKHSNSQRQWQQHISSEKHKD
RVFSCEGEDEALTWRYRFPGVHFDICPKLDGGCSEGVSCDFAHSAEELQEWIERRDFLRQ
KLAKAREDMLVLPDELDFGKFNFLLQD
Download sequence
Identical sequences H2MGH6
ENSORLP00000017714 ENSORLP00000017714 8090.ENSORLP00000017714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]