SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017770 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017770
Domain Number 1 Region: 93-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-17
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 135-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000326
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 22-74
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017770
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017770   Gene: ENSORLG00000014168   Transcript: ENSORLT00000017771
Sequence length 187
Comment pep:novel chromosome:MEDAKA1:1:35672311:35672871:-1 gene:ENSORLG00000014168 transcript:ENSORLT00000017771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCGVCGRVFSSSAALETHVSLHELNKPFSCSLCGKSFLDSAGLKRHGRVHRNGRIHVCHL
CGKGFVYKFGLSKHLEMVHDKIKRFICQTCNKTFFTKRDVEIHIRSHTGETPFHCNLCER
QFTSQVKLNVHLRWHNGEKRHWCPYCDKGFLDYNNLKRHKYIHTGERPCSCPYCPKNFTQ
IGHVRKH
Download sequence
Identical sequences H2MGN2
ENSORLP00000017770 8090.ENSORLP00000017770 ENSORLP00000017770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]