SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017795 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017795
Domain Number 1 Region: 99-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000268
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 7-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000868
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017795   Gene: ENSORLG00000014186   Transcript: ENSORLT00000017796
Sequence length 257
Comment pep:novel chromosome:MEDAKA1:1:35699620:35708650:1 gene:ENSORLG00000014186 transcript:ENSORLT00000017796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRDASNSCSASFPNSVSLKTHKRTQKSTKQGVPFSRNQSTKSFSQACNLQAHQKTHSAQE
LHLCSHCGRGFSSFEDLRSHKCGQIGDKPYCCTVCGNKFSRLWNLKLHQRIHTQEKPHRC
NMCDKSFTRADILKIHQRTHTGERPYCCSVCNLSFKRLDHLKSHQRKHINLHLLRCGQCG
KCFPHPSNLKAHLQTHTGERPFCCSLCGRSFTKLSNLKAHRRVHTGERPYCCLACGKRFT
QKCNLKRHQRIHLNIWI
Download sequence
Identical sequences H2MGQ5
8090.ENSORLP00000017795 ENSORLP00000017795 ENSORLP00000017795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]