SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017905 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017905
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000912
Family THAP domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017905
Domain Number - Region: 188-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000214
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017905   Gene: ENSORLG00000014279   Transcript: ENSORLT00000017906
Sequence length 217
Comment pep:novel chromosome:MEDAKA1:7:21606169:21609128:-1 gene:ENSORLG00000014279 transcript:ENSORLT00000017906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALICCINGCKNRYSPGSHIKFYRIPSGSRVFQAERRQLWLDAIQKANGSTKKLNQQSRI
CGAHFISGEASPDYDMPDYVPTVFTCTKQRPNSKKKRVEWIYRSRKKRRRRANAGTESTS
FSGQNTPEKAPPSPIVQEEVELQTEEILTETVCLQTASNLNTVSPSPMESVPQGMSPVVI
LKSILSPAGGFFCDLCHQTFHNVSELINHHRLHHVQL
Download sequence
Identical sequences H2MH09
ENSORLP00000017905 8090.ENSORLP00000017905 ENSORLP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]