SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017944 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017944
Domain Number 1 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000069
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 451-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000558
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 507-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000054
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 423-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000387
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017944   Gene: ENSORLG00000014311   Transcript: ENSORLT00000017945
Sequence length 641
Comment pep:known chromosome:MEDAKA1:23:14537740:14540769:-1 gene:ENSORLG00000014311 transcript:ENSORLT00000017945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKYFSFAGARLPPASLQLLVPPVRLMSALAWQVAQEHSVLQYDKLLDFINLVMEIVPEIL
NPIQKAQLIMGLRARLVLELCHVDGVTNLKTIQNHLDKIHSCSSELSSIDQMSDTLKNFA
TLVQKILSVPFEKETFFHEVFPKKYGSAFNQGIQQLVSVFLVRLEQLLPVPDLHETSALL
TGSSTPEEFSRSLSDPVALKTLLLHYRERGTLSSSQNKNSFFMIFINWRTFTFLCQKLTQ
ALTSNEEDIILHTLAHPPEERLPVNHIEGDDDKYDSDARTLALEDVDEDLAESLEDTSED
WGPKRESDLVSHLYICSECSFTHCCIKKIQEHIQKEHQKTGIKPRRKSSKTVSLGAKIKK
KDIEKSSKKEKKGTMKNSPDKKLNCEQNQDKPGNRKSQRRKEPTGVDKRFLSTRPENKNF
SEEETRCQTCEKVFEHPNQLRTHMRIHSFRYHCSLCEKGFTSQSGYYHHQRLHKKGRIFK
CDLCNKGFLCSNSLNQHKRLHDGPTNLCNVCGKHFSKNGFVRHMQMHKGERNYLCTTCGK
SFFSSGELLLHNRSHTGELPYTCIHCGKGFSCKGHLTVHLRSHTGERPYACLECPKRFLT
VNCLKRHALSHTGVKPFKCTKCEKEFSQQGNLKRHLATHKP
Download sequence
Identical sequences H2MH46
ENSORLP00000017944 8090.ENSORLP00000017944 ENSORLP00000017944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]