SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018038 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018038
Domain Number 1 Region: 265-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 170-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000228
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018038   Gene: ENSORLG00000014390   Transcript: ENSORLT00000018039
Sequence length 338
Comment pep:novel chromosome:MEDAKA1:12:26948382:26951089:1 gene:ENSORLG00000014390 transcript:ENSORLT00000018039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKNKRCASYNVHRSPEKEPKAAACAGITLVFAVDFRCHAAAPEVVSHPNQLVCL
HAPSNLVTKPAVSAPGLPNMTPPPLPSSGLSSKFSRFIYITLPTPEPHVDEFSPYYKPAF
AWEPAPSRFELRQLSFSPTASGLYGGRISRSPPTQQPLDCSTHYTPLSSTYHCITCDKVF
STSHGLEVHVRRSHSGMRPFGCSICRKTFGHAVSLEQHMNVHSQEKSFECKMCGKSFKRS
STLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLI
THSRKHTGFKPFGCDICAKGFQRKVDLRRHHESQHGMK
Download sequence
Identical sequences H2MHD3
8090.ENSORLP00000018038 ENSORLP00000018038 ENSORLP00000018038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]