SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018135 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018135
Domain Number 1 Region: 2726-3007
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-73
Family Protein kinases, catalytic subunit 0.00000279
Further Details:      
 
Domain Number 2 Region: 1260-1438
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-50
Family DBL homology domain (DH-domain) 0.0000000154
Further Details:      
 
Domain Number 3 Region: 1924-2128
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-45
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 4 Region: 1445-1564
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-33
Family Pleckstrin-homology domain (PH domain) 0.00000106
Further Details:      
 
Domain Number 5 Region: 2124-2246
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-26
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 
Domain Number 6 Region: 2622-2717
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-21
Family I set domains 0.0068
Further Details:      
 
Domain Number 7 Region: 825-976
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-19
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 8 Region: 1071-1210
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 275-410
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 10 Region: 495-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.5e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 11 Region: 1625-1691
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000235
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 12 Region: 2487-2554
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000108
Family SH3-domain 0.00019
Further Details:      
 
Domain Number 13 Region: 34-182
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000654
Family CRAL/TRIO domain 0.0087
Further Details:      
 
Domain Number 14 Region: 191-306
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000995
Family Spectrin repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018135
Domain Number - Region: 415-527
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0146
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 719-800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0273
Family Spectrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018135   Gene: ENSORLG00000014469   Transcript: ENSORLT00000018136
Sequence length 3038
Comment pep:known chromosome:MEDAKA1:11:29271172:29396471:1 gene:ENSORLG00000014469 transcript:ENSORLT00000018136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGEGAEETKDAGGLDALKNGFRRNEETRAMEVLPILKEKVAFLSGGRDKRGGPVLTFP
SRTNHDRIRADDLRRLVAYLYSIPSEDVCKHGFTIIIDMRGSKWESIKPFLKVLQDSFPS
CIHVALIIKPDNFWEKQRTNFGSSKFEFETTMVSLEGLTKVVDPSQLTADFEGSLDYNHE
EWIEVRVAFEEFSGHATQMVARLEEMQETVSRKDFPQDLEGARLMIEEHASLKKKVMKAP
IEELNTEGQRLLQRIHSSSSGNSVCNIDTQSLVLRITQLLDKLHSIRQHILQSWHVRKLK
LDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTDIGNNHLQAVELQTQHKHFAMNCMNVY
VNINRILSVGKRLLDSGHYATQPIKQISGQLEQEWKAFAAALDERSTLLEMSANFQQKCD
KYINNVESWCKVCGEVDLPAELQDLEDAIHHHQGLYEHITAAYSEVSQDGKALLDKLQRP
LTPDSTDSLTASANYSKAVHHVLNIIHELLHHQRQLENIWQHRKVRLHQRLQLCVFQQDV
QQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEDVAQNTYTNADKLLEAAEQLA
QTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHTHVKEMWTSLRVLQRELL
YEVYQSRPEMIHQRYIKNYTGSPQRTSRMVNLNIIYKNSVYICNFRDSAISSNKTPHNSS
INHIESVLRQLDEAQTQMEDLFQERKIKLDLFLQLRIFERDAINIISDLESWNEELTAQI
NDFDTEDLTVAEQRLQLHADKALTMNNLTFDVIHQGQELLHYVSDVQASGVVLLCDRDGD
MATRVRELLEFLHEKQQELDVASERHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAG
LITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEVLLQANHYDADLIRDCAENVA
SHWQQLMLKMEDRLKLVNASVAFFKTSEQVCSVLESLEQEYKREEDWCGGGDKLGPNCET
DHVTPMISKHFEQKEAFLKACTLARRNADVFLKYMHRNSMNMPGMLSHVKAPEQQVKNIL
NELLQRENRVLHFWTRRKRRLDQCQQFVVFERNAKQALEWIHDTGEFYLSTHTSTGSSIH
HTQELLKEHEVFHVTAKQTKEKVKLLIQVAEGFCEKAHSHASEIKKLVTTVDKRYRDFSM
SMDKYRCSLEKALGISADPNKASKDLQLDVIHATAPGSEVKLRDAATHELNEEKRKSARR
KDFIMAELIQTEKTYVRDLRECMETYLWEMTSGVEEIPPGIVNKEHIIFGNIQDLFEFHY
NIFLKELEKYEQLPEDVGHCFVTWADKFQMYVNYCRNKPDSTQLILEHAGNYFDELQQRH
RLANTISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKEGLEVMLSVPKRANDAMHLSM
LEGFDENLESQGELILQDSFQVWDPKTLIRKGRERHLFLFEMSLILSKEVKDSNGRSKYI
YKNKLYTSELGVTEHVEGDPCKFALWVGRTPTSDNRIVLKASNIENKQDWIKHIREVIQE
RTIHLRGALKEPIHIPKTTTSKHHKGRSLRDREDLDSQGESSSQPDTISLASRTSQNTLD
SDKLSGGCELIVVIHDFVASNNNELTVRCGQTVEVLERCHDKPDWCLVQTIDRSPPQEGL
VPCSMLCIAHSRSSLEMEGIFNHKDTLSVYSSDSIMAGSSATFQQGHGISSHASPGPKRP
GNTLRKWLTSPVRRLSSSKADGHVKKLANKHKKGQDVRKSREITAGFQRDSDDCAATPQD
ESLEERVRNEGLSSGTLSKSSSSGMQSCGEEESEEGTDSVPLPPPMAIQQHCLLQPESQE
DKTSSRLFVHLSGSETPSTAKLVSAIKELVKSKMAPEDRPSSLSVDLADCSSPSFNSLLS
SSSPISEMDEHRSSFSNKRRFILLELVETEREYVRDLCMLVEGYMSMMKEEGVPDDMKGK
DKIVFSNVHDIYVWHKDFFLRELEKCLENPDRLGPLFFKQERKLNMYITYCQTKSKSEHI
VLEYIDTYFEELKQRLGECLQITDLLLKPVQRILKYQLLLKDFLKYSKKAGLESVDSERA
VEVICIVSKRCNDMMNLSRLQGFDGKIETLGRLLLQDTFMVSNPEGVLLGQMTERRVFLF
EQMVIFSKPLDQKAALCLPGFLYRNSIKVSCLGLEETVEGDRCKFILTSRSLNGITESFV
LHSSHLGVHEVWTLQVRHILGSQRNCLPAVPPPKEYQENHVETSSSVGVGSAGSGSSPGI
SGGNFQSRSNHSGSQGGPCRPSRIPQPSRLHLRSHQGNDADGPSRISGSNPRSVPSPVLP
VGSGPLGKCSVQTSEDKAIALPSAGTTTSTLCAMASTPTSKLWQGAVSPHPIASPLVTSA
FGTEAFPPPPSSPCQKFGPGFWSSIPGSPASRPGAFTFSEDGGEVQSGCGGQIHRLSTHS
KEADRMSTCSSASEQSIQSTQSNGSESSSSSVSTMLVTQDYMAMKEDEISVIQSEVVQIL
ASNQQNMFLVFRAATEQGPAAEGWIPGFVLGHTSAVSPDGPDMNIKKSSSWHASLRIRKK
PEKKEKEVKKDSKLENGYRKSRDGMPSKVSVKLLNPNYIYDAPPEFLVPLSDMTCNTGKN
AMLSCKVCSRPRATVSWRGPNQSNLINNEHFSITYSDTGEATLRIISAASEDDGVYTCVA
TNELGSVRSSASLHVLAVTTDGVQVNWKDNFESHYMEMVELGRGRFSVVKRCDHRSTNRS
VAVKHINKKLMRRDQVTQELNLLWRLKHPHIVSLLDIFETSSSYALVLELADQGRLLDYI
VSWGNLTEEKVASYMRNVLQALHYLHNSRIAHLDIKPENLLVTHNASGQPVVKLADLGDA
VQLNSAHYIHPLLGSPEFASPELVLGEPVSLTSDLWSLGVMTYVLLCGASPFLDESAEET
CLNICRLDFSFPREYFHGVSQAALDFVRLLLRTEPGRRPPVGLCLQEAWLQAGQSNRTET
CLDTSRLVSFIDRRKHQTDTRPIGGVRGFIRSRLQSQI
Download sequence
Identical sequences H2MHM4
ENSORLP00000018135 ENSORLP00000018135 8090.ENSORLP00000018135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]