SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018138 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018138
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily POZ domain 4.51e-23
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 367-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000123
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018138
Domain Number - Region: 229-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000168
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 453-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000844
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018138   Gene: ENSORLG00000014474   Transcript: ENSORLT00000018139
Sequence length 526
Comment pep:known chromosome:MEDAKA1:24:8559589:8566526:-1 gene:ENSORLG00000014474 transcript:ENSORLT00000018139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELANHGLILLQQLNSQREFGFLCDCTVAIGDVFFKAHKAVLAAFSNYFRMLFIHQDSDC
VRLKAADIQPDIFSYLLNLMYTGKLAPQLIDPARLEQGVRFLHAYPLLQEASQSVYTHPD
QSINLSTSLYGIQISDQKGALSAREPTRRQLSSPFDAEQTGSEGKVPSTPAALSFVNSSP
PKQASSPSDLGATTSGMKPLTEEMGMDVLNADGSSAGAILHVKPSIMKRNSSFRKHYSCH
VCRSRFTQRSLLREHLLQHSQALLHSPAEPSKVLSPMVTGEHSMAAESVREIKLGSSGSV
AQAAVEVISDSEQTPVSVTNSDSPQAEVSTSTWGVGGLNSQADTPPPSDIADIDNLENAD
LDREVKRRKYECSTCGRKFIQKSHWREHMYIHTGKPFKCSACGKSFCRANQAARHVCLNQ
GADSYTMVDRQSMELCAAGDDSSQMEAMFLGSTKPYKCNICATTFSSPSEVIKHLCFAQG
GLAGLQVSTGASMLLQREELSKDEGSDLSNSGTPVEPIKTEEILVE
Download sequence
Identical sequences H2MHM7
8090.ENSORLP00000018138 ENSORLP00000018138 ENSORLP00000018138 XP_004083651.1.28442 XP_020570550.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]