SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018203 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018203
Domain Number 1 Region: 178-200,348-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000417
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018203
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0171
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 517-538,688-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0254
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018203   Gene: ENSORLG00000014523   Transcript: ENSORLT00000018204
Sequence length 732
Comment pep:novel chromosome:MEDAKA1:1:38285013:38294869:-1 gene:ENSORLG00000014523 transcript:ENSORLT00000018204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSGPVVCEVCGLYFETRRGLSSHARLHLRQLGVTVSESSGAPIELLYQLIQERDGSLSAF
NADPSGAGSTAPKKKPQQEPKTSSVQEEKSSTSKAGGNRSTAPQNFVAAGTRHGEVSPVT
PEPTFAKLGSPTVMMEEDPKPLSAELQDEGASSPKRPAELSSPPTSPASKRPKASEDCTC
VLCGEQFENRKGLGSHARSHLRHIGVSDLVGKNSAIDTVEELVSSGMIEVMHPPKTSSSP
ATTSPAPPSPGLPASSPPPSQGRTVFLSSAPPQSPKMSSQVPLHPSNRAPKAKKGFRLAV
DPLLRKPKPEPVEVEVSESKTSSPEDGSSVASFPAAPTSAAPLDSDLQSPPTVLCDFCGQ
LFETRKALSCHVRAHLRQLGLTWSIRTSPIDLLKEVMLHGEDGKAKQPWAPQGSKRPRRS
LSAEEGASTSCTSPVDYSMKDKSLPGKTAVPRVGKSPGFRSTSSGIIRDSQLSEPMRLFR
LDQQELALTAHKHLLFKHLFRFALERRTKSCFCTYTCCQLCGFDFENRKALASHARAHLR
QLGIFEWKVDGATSPIELLSEIIQKDPARVAEITKRYRFGDLYIKKVGCALMTFCKSQRT
QRSTSPSASPDSGAVGGGSRRTFAQQELKASRKDHGSMSAHTPKGVHPLKHGVSSGQENR
KPQRPPRSGSIPALLPKPPLTPLVKLVGKVYSLKCRFCDEVFHGPLSVQEQWISHLQKHI
LLLGYKSTEAAP
Download sequence
Identical sequences H2MHT5
ENSORLP00000018203 ENSORLP00000018203 8090.ENSORLP00000018203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]