SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018302 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018302
Domain Number 1 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 323-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000167
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018302   Gene: ENSORLG00000014600   Transcript: ENSORLT00000018303
Sequence length 448
Comment pep:novel chromosome:MEDAKA1:19:21746720:21749664:1 gene:ENSORLG00000014600 transcript:ENSORLT00000018303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTAKTLEKVNPVNLGGFVHPTGESVYSVDDIATGLPTSVAIFPNADLGGHYDQLNVAAA
DSLMDMCTEKRSMDLSSYSTGFSQPPSHRNQTFTYMGKFSIDSPYPANWSPDGVINIVSG
IFNMTQPPPPPPPPPSSSTSSSPASSGSPHHFSSGNLSCTMAAQSQAEIDHPHHPYSPPP
PYPSSSCPEVYHQDPSAFLSTSTCPISSYPSTPYPSPKQPSSLDAQGLFPIIPDYTGFFQ
PTCQRDMHTAGIQDRKPFVPCPLDTFRVPPPLTPLNTIRNFTLGGPGAGGSDAGQQRLPS
AYSPQNLPLRPILRPRKYPNRPSKTPIHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHK
PFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQKERKS
SAVSSSSSSSSSSSALFLFPFAAQTATH
Download sequence
Identical sequences H2MI30
ENSORLP00000018302 ENSORLP00000018302 8090.ENSORLP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]