SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018341 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018341
Domain Number 1 Region: 664-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000469
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 494-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000187
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018341
Domain Number - Region: 1016-1073
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000186
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1283-1305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000447
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 1184-1212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00139
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 724-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0131
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 1250-1277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0214
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 844-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.032
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018341   Gene: ENSORLG00000014636   Transcript: ENSORLT00000018342
Sequence length 1712
Comment pep:novel chromosome:MEDAKA1:22:9532268:9545058:-1 gene:ENSORLG00000014636 transcript:ENSORLT00000018342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDVLRQQPISMASSTEYCDNFCQALMHYAGSRNSMEHGLPLLEVYCLSINCFAAARSHLT
AESDRVALVLKRLALSCFELLLSVPENEIPFEAWVQFNQSVQIAHDSLLQFGSTDLQALL
QITGEGGAWSNPILTALLTGQATNPDEVEAYILLEGEGFMEMRVKHLEKMGEVAKAVVLA
KACSECSFIPNQAMFRQTFVSLLCHLLPNEEAIIEISRLDCKDVLEITCNLEMEGEENTA
FILCTTFLTQQLQQQNLYCSWELTLLWSKLQRRLDPSLVSLLERCLQLGAIAKTVQHLLY
LVRVIQTEAEELGTPASVELCVKALQLPKQEDSETRISVCKTISCLLRNDLEVLRACQLT
ELLLGSSQEAFTCLEELYLRPDQKYDQENEVIPNSLRCELLLALKAYWPFDPEFWDWKTL
KYHCNFLLGLNAESEGEGEQEKEVKTKKLEVPVVQKRVETDLHCRINGGLGSHEHQDKKE
PHPEVDASSEVKREKFCCKICKRSFTDTQIVHHSKRHSQENNHLCPVCLEKFKSRKDLVP
HMKKHIGSKSIPSQNNTKDPSLVLYYNSTRDPDLLHHIVQQTKTSKEKSPDDDEYVTFDY
IEHHFKLQNRDEYPCPGTKCKRVFKHSKYLYVHLKSDHKGDENVKYFHQMRDKREKCVFC
RRHFVSAYHHRKHRRAHYGDQPYTCVVVGCGAKFSTSNELVVHKQTHGYQLSYQCELQGC
YVTYADLGQLYHHEAQHFRDAAFACCSTECKKYFLSKKEFMKHLSTHKITFTEEDFEAQR
KAKRKLFKIITEPPVGFNQLSDPTDGVNGEVLNPPSMSCASSVEDFPNKEPKATMTLVAV
CFDGSKFTCGFEKCGMTFSRARDVQRHLKCAHPEHLKLENREHKHDKEQGSKGMDTNVAP
DGEEKETDEHSAPLKPVETDKKTATPPKSNETSFLSRHAKNDGLKEILLGLSKLSLNSVP
LSSPSEPSQSSQDASLKFSHQAILEKPPVVLLNKNSDMSDEQMVVAKEEYTESLGNAKPY
VCVYAGCGFRTAKSYSLLRHYISKHGCSLEEARKMTSFKTTSFKPYACQLCSKSHREKHV
LRAHYIQAHKMSGALVDKISCGTVQLEQDKKSSSQPLSNIDPKGIKKETVIMEHQQKSNT
PSLISENGQNSDNHSPETKTTQQVRTRRLVAKNNLCYILDKFSKPFHCVAKNCDAAFSTQ
GGLVRHLQFIHHYNRSQLLLDKDSDVQGPEVRKEPARKRAQPNPDEPQPQFKCHFANCHA
VYHLKSSLVRHTRDFHSQPPELIRCKHEGCSRVFSHSSALKKHMLYSHCEYYDSLVVRLQ
STHKKRVARKQTLVHQTHMMGHRVQENRGNSSQKKKESGAKKSKRANVSDLVLRSHEEAL
QMCQDRCLRMAYPCMVQGCDSVVKYLHSVHRHYMKVHHLGREELHKNADTLVFHAERLEE
LIQRKSAQPAATGAGSPNEGQEKETLKESESPEEQPEPTGVPSVPEEQKEEKEEPSPVET
NEVPVGSNEVVEGEASTDEKPEEMPVAPQSSPKLEERLRMVNGSAAVSSPTVRLPLKRKN
EISEQPSNVKDTQPSSPQHSFDITAYKPIGFESSFLKFIQETAPKDEEALVKRRDTFKRS
CSVKENHHLGISHTRGRRTHSPLLKSNSTTGDFTSIQNLKSILDKALAGCGDLAIKQLQF
LKPVVVLGRPVCTTLPDLFPSDTNNSKLLLGS
Download sequence
Identical sequences H2MI67
ENSORLP00000018341 8090.ENSORLP00000018341 ENSORLP00000018341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]