SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018441 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018441
Domain Number 1 Region: 25-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-22
Family Growth factor receptor domain 0.0000932
Further Details:      
 
Domain Number 2 Region: 195-256
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000301
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018441   Gene: ENSORLG00000014713   Transcript: ENSORLT00000018442
Sequence length 257
Comment pep:novel chromosome:MEDAKA1:21:17742326:17750432:-1 gene:ENSORLG00000014713 transcript:ENSORLT00000018442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMFLSFCLLVTFLLGLSGCLGSYVPCEPCDDKAMSMCPPVPLGCQLVKEPGCGCCLTCA
LSEGHACGVYTGTCSKGLRCLPRSGEEKPLYALLHGRGVCTNEKGYKPAVPPAGGHTKAK
PTGREVVGLDCNVLFTSFVAEFESREHEDTITPEIPGELQPAKVPLHPKDIVNSKKNIAV
RKEQKRKQTKQRSMGATLDYTPLSIVKHEPEFGPCRRKLDGIIQGMKDASRVIARSLYLP
NCDRRGFFKRKQSKPSK
Download sequence
Identical sequences H2MIG2
ENSORLP00000018441 8090.ENSORLP00000018441 ENSORLP00000018441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]