SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018553 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018553
Domain Number 1 Region: 705-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000012
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 2 Region: 1909-1936
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000405
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 1506-1572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000366
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018553
Domain Number - Region: 1764-1792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000264
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number - Region: 756-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000626
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 534-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0046
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 656-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00538
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 997-1025
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0875
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018553   Gene: ENSORLG00000014801   Transcript: ENSORLT00000018554
Sequence length 2289
Comment pep:novel chromosome:MEDAKA1:22:9731695:9743372:-1 gene:ENSORLG00000014801 transcript:ENSORLT00000018554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGETEKEYDTPKAIEELRERFQGLTTALKESTKSPLEASLLFCQDFCQVLVEHAGRWK
TDEDPLPLLEVYTIAILSFAKASSCLSSACENVPLLLEKLALSCAELLFLLPQHVPGALW
EEFQSSMKVAHSLLQESGSSPLRLLTSLAQQDGVWANATLSSILSNQTPQTEHVHQYLEL
EGPTLLNMRIKHLIKVDSVDKAAVLAKVCSEFPGFEGQGNFKQTYLLCACMTKSQEQLME
EIALIDCKDALEMICNLESEGDEKGALCLCTTFLKRQLLQGEVYCAWELTLFWSKLLMRL
ESSADSFLSHSKEMALLCTSVCHVLFLIKVIQNEVGEVGLPVCVEMCIQALKMTSSDHKD
SKSTICKTIYCLLPTDLEVKRACQLTEFLLQPTVESYYAVESLYNEPDQKSEEEGSLPVP
NSLRCELLLALKTQWPFDPEFWDWKTLKRNCLALMGEEAAIVSSIDTLNDTDEQEMESAL
GKLPEYKDLEDFLLTTTNELNEITDEKEKNREAKKLREQGFVSARFRNWRAYMQYCVLCD
KEFLGHRIVRHAQKHFKDGMYLCPICADSFESREILEPHVASHVKQSCKERLAAMKAARK
VAKPPHSPKSPSKISKLAVKAHMSPGRGESQIAGQLGAPIKMEQPVSDSQISQDCFCPVK
NCSKAFKFFRNLMAHVRSHKDDEEAMRFLEIQKQKVVCQYCRRQFVNVRHLNDHLQMHCG
SKPYICIQLDCKASFNSNSELLMHRKMHSEFKAQCMFPNCGQVFSEAYLLYDHEAQHYLT
YTCQTDNCGKIFYSQSEFLSHQNYHNLNYAVAGQASAAPPEAQPPPPPPPMTLSKEDAPS
VAFSHEKNYSDVYVSESSKANAWGSIEMAKEAVSMKVKHSIENMLNSMAGPEIKEPEKCY
TPLTNPTPTPVDVNLQPEAQHVHHNIPGQGDIPQVYPVPTAEKPAVSLRKNLPSDGLNDE
FPNVIPQIISPSQIKMEVPCSLQGYPCSTSALVPAGSEENLHCCPSTDCSRAYSTNKSLS
RHVKKQHPEIFEDWKLAKKYNKVAKITAKKGNRPSTQPGILCNKPGVQQMDYSAECSTPP
SQCYPGSMEPVPITPMVNPTLYPPWGCPNNQNVMMPADMPQSWSSPPMNNCYPDAFHMNE
YPTRSYPHWQPDPYQTTMPHPSDRDHPVAAVHGSAMLQAPSDSSLMSQYVSSSLMLDNGG
QMHNGGHQYGLMQPDGTGENVDARKSAANMTGHFDSGNSISTIDSLPEGGYHTPYAPSES
SCLTQCSSVDIPIKCLSPEAPVPPKPPTNPSDEKGGDSDAQRGKRNRLSKRTKWPAIIKD
GKVICRRCFREFTSTKSLGGHLSKRSQCRPLDEVDLTADLPTSFLDFLNDPHVPDANGAI
YNMPNGDFSQESCGLTTLTSSVMLKQEPHSTNIMDHSSSVSVSQENQQENATEMAYPTIV
GPYQEDNLMEMSHAFQKMDLIEAAQEKMRKAMLSQKSVRKREPASETEKSKPPNKKEEKP
TEKMPKPFKCDQADCDFSFMTKEALFKHLSKMHDYSSEMIEELKRTPSKLSPYPCQICAK
TFTRTTGLRIHYEKVHRLSKAEMLKLKINARNRRAFRLNKDETTNNGPNIEPNSSATTNS
KPAMPLIKQEPLDVAIAPQPEETKPPNIPEIPLGDEIKQTSTPEVVTVTRLPSPVSNVTE
KAPVEGPHLKEKLSPVGKTKAQQEKSSLPQSRAKEPKSSNESTLSSPERPSSSKSTPTKE
KKEKVQKRVSLKMSDTDNAYSPYRPYRCVHEGCTAAFTIQHNLILHYRAMHQASLPPNEI
DSDAENTSVNNVQESVELPMGKDNEVRCQVKNCSRVFMGITRLVQHYLLLHKFSRDKATS
MMASMTIGTFNCDRTECALPFDSVDKYIEHIKNYHKEIAISESGSVDPTFRCEYDGCDRV
YTTKSNLLRHLIKKHDYVYDPKATDGRRTKSIGLFPGVNNGKENVENKLKAKKKNTKKKD
AKPAEHWTSFGKPTLKSHEEASAMCTKKSSLQYPCMIVGCDAVERAERSIFKHYTTHGLT
EKYIEDQRSQFIFCKKYSRSRFKEAEKTEAVSASSSEETEPDDGEKQCEQKTEEPVADKV
GQEDGKLSNDDGAESHASTVTEGGIKRGRPRKPAHPTPACPQRIQTLRNRSTVNNSRENS
NPGTPADQEQRDDGATPGSFKPLGLEDSFLKFLETSESTNPSKRKLNEKPSCEVPCKRQQ
THRAKASAKSKTSDEIRGGENPVDFKNPLHLKSGNNVKIVIDKSLSDGADLVLKQLQHMK
PIVMVKRWL
Download sequence
Identical sequences H2MIS0
8090.ENSORLP00000018553 ENSORLP00000018553 ENSORLP00000018553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]