SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018888 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018888
Domain Number 1 Region: 226-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 169-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000269
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 267-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000163
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018888   Gene: ENSORLG00000015072   Transcript: ENSORLT00000018889
Sequence length 319
Comment pep:novel chromosome:MEDAKA1:7:22403493:22407582:1 gene:ENSORLG00000015072 transcript:ENSORLT00000018889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKIKLDDFSSSNVATSNHHHHLEDSFTFARSITDSVTSLGVRLSENGYIQDYI
TPSVFQGEKKMEHKLTSPVSDPLYTQVSSGGEYCDPDLKHPDSPQSGMTASGFYTGESEA
LAEGYTMDAFFISDGRSRRKGEGEQRESGSRSSSANGGVQERGGGIPRHTCNECGKTYAT
SSNLSRHKQTHRSLDSKMARKCPTCGKVYVSMPALAMHILTHDLKHKCDVCSKAFSRPWL
LQGHMRSHTGEKPFACAHCGKAFADRSNLRAHMQTHSAFKHYRCKRCNKTFALKSYLNKH
YESACFKGSGDEDDSGSEN
Download sequence
Identical sequences H2MJN9
8090.ENSORLP00000018888 XP_004070917.1.28442 ENSORLP00000018888 ENSORLP00000018888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]