SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019040 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019040
Domain Number 1 Region: 13-203
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-60
Family Eukaryotic proteases 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019040   Gene: ENSORLG00000015198   Transcript: ENSORLT00000019041
Sequence length 210
Comment pep:known chromosome:MEDAKA1:16:22559251:22561760:1 gene:ENSORLG00000015198 transcript:ENSORLT00000019041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKKKKTLTFVFHSCRYKMFEAADWLVVVGSVSLADNSGKRYRALQILYHPGFSSQNNDYD
VGLLRTITDIDMTDGVQPVCLPRRNEIFPVGADCWITGWGSTQEGGSVSEELRQAQVKII
AQVTCSSSRVYGDFITPQMICAGSMVGGLDSCQGDSGGPLVCQTSSGDWKLAGIVSWGEG
CARPNKPGVYSRVTELLQWIEESSEVQHHT
Download sequence
Identical sequences H2MK36
8090.ENSORLP00000019040 ENSORLP00000019040 ENSORLP00000019040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]