SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019065 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019065
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily POZ domain 6.8e-33
Family BTB/POZ domain 0.00074
Further Details:      
 
Domain Number 2 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000022
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019065   Gene: ENSORLG00000015218   Transcript: ENSORLT00000019066
Sequence length 592
Comment pep:novel chromosome:MEDAKA1:13:30983876:30994033:1 gene:ENSORLG00000015218 transcript:ENSORLT00000019066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKTFTHSSASHSQEMLEKLNALRNEGHLCDVTIRVQDKLFLAHKVVLACCSEFFRSKL
VGRPDEEDKFVLDLHHVTVSGFAPLLEYAYTSTLSISTENIIDVLAAASYMQMFAVASTC
SEFMKSSILWSSSAEKPHESAPESASSNCALTPLDGSVSPVSSDCSVMERNVPVCRESRR
KRKSFVTMASPESPLKCTAQMVTTSPQIPNPSPSFSDGTAQPVESSLAFPWTFPFGIDRR
FHSDKSKHLESPRCLEQGTSAGSEVVVSRRLTDFLSCESAKAVSSPTAAEEEDVRVKVER
LSDEEVQEASSQPVSASQSSLSDQQTVPGSEQVQEELLISPQSSSIGSMDEGVSEGLPSM
QGTSNAGGHAEDDERLEGIQYPYHLYISPSARPGTNGPDRPFQCPTCGVRFTRIQNLKQH
MLIHSGIKPFQCDRCGKKFTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVS
RHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLSQVQEE
EEALGVQYELEESQHHHAFPGSSSAATSTATSSSSSVQLPVISQVSSSTQIS
Download sequence
Identical sequences H2MK60
ENSORLP00000019065 ENSORLP00000019065 8090.ENSORLP00000019065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]