SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019134 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019134
Domain Number 1 Region: 152-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-18
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 199-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000022
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 3 Region: 105-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000337
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019134   Gene: ENSORLG00000015277   Transcript: ENSORLT00000019135
Sequence length 1122
Comment pep:novel chromosome:MEDAKA1:9:23963228:23970666:-1 gene:ENSORLG00000015277 transcript:ENSORLT00000019135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPMTAPPLTPTTLSSSMQTTQPSSASSENSRGDSTVSSTVNPQSTERSKVKTEDEGPLPI
LPSFQVQSFIQVCVLLQDQSGSISDLREDLDKDDCKQEPDAIYETHCHWDGCSEEHDTQD
QLVHHINNDHIHGEKKEFVCRWENCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSK
AYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCT
KRYTDPSSLRKHVKTVHGPEAHVTKKQRSDAPPRLQICKAIREAEPHSGKGAVGSDGQTD
ARSTCGVDNRLQARTVKAKNPVMYQSGSGGLSSCSSEPSLLSSANNNHSGVDIAIHSGGS
FGDLSSQDEAPMADSTVPSRVQQVGLRFQLSKAANHCGEVTIKLENINKERLKTVRDWCV
CVPGAPQPPQSLCSGIRLPPISAVGSLLDTCKTLSSLYFEQPAVEVTRLNQMNERRHNTT
STISSSYTMSRCSSDLLPCYSSRHCSEASQFGANPHNNISSAESYDPISTDLSRRSSEAS
YSGGMGVGFPGILSLTPAQHYQLKAKYAAATGGAPPTPLPNEMSLRTCKGVYRDSQGGLA
HTFYQPFSRNVPRRHSGTTYVTQSMMPHEVPNNLPRRESDPVHHPNQECFSFKRVQRSKS
LNTLISLSMSERHHMPATLGCAGSLQYNPFVPRPPSISEQVFIDNMAADGMKTGDEPSGD
EDMVLPDDMVQYLKFLNSAHSCDPCSQSQGDQAGTAPSPSFYAHRTAMVNSGMSQVNQDL
QMGTEVSQQPFSESCNNSNKNMPVQWNEVSSGTMDTTTRLCRGNLNYDLNSSQQVVPISL
NASMQSLGNQHNQRLMTVSRRPHQQLRQCNMINVRAQDAKSVSGSTNMQPIHNCVVDPAF
HIHRTRTPTDGQNYSNLSLHQNCGTLLPRPPSEPKPVTRQNCSFSEQASQTPRSSGTTSG
PSMDSSEATLKRRNMSTSHDSKSEDHNQANFYTGQTQTFEPLSVSFEVSMSAGGPNNHMA
AVNTASPGVNQVSSSTTDSSSCEIWRSEHAMLDYGDHSSMVSGSLSPRLLHSLSQMSSRL
TTPRNSVALASVPAGISNMAIGDMNSMLTALADESRLFNMIS
Download sequence
Identical sequences H2MKC3
ENSORLP00000019134 ENSORLP00000019134 8090.ENSORLP00000019134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]