SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019150 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019150
Domain Number 1 Region: 421-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000042
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 376-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000131
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019150
Domain Number - Region: 485-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000896
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 345-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0462
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019150   Gene: ENSORLG00000015289   Transcript: ENSORLT00000019151
Sequence length 513
Comment pep:novel chromosome:MEDAKA1:6:22996367:23003115:-1 gene:ENSORLG00000015289 transcript:ENSORLT00000019151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVCRLCHGKFSPRSLRNAFNKLPQDSPDTVGAATQSPLLFHSDFQRLVGVRLDRDPRLS
EFICKKCHAKFYKCHGILIRFLQRVNIPPVGKENLKIQKNAKCPESTMNYSSKTPSSFTS
DPKCLHSLVSWAHHHGEACRFCPDLKEVLEGQCWGSVKAVWGCVDGHRYIMDTRYTPPPC
LSRAESLKGGDLGRGIGDGELSDVSSQRQSGLPAAAVQMQNSAPDEWTGSSEGSNASVRV
LDLHSSGFFSVTDCAGPEETTSPAPVQLEDQTADSDLSDRNLKHHFLDLSPHRVVSEEEC
EEGTKGSLSDEEMFEPYAEKRVNGPDKRRQSLKSTEEPKVRKKPGPKPGWKNKFKPKGEE
LPNIYKCPYQGCTAVYRAPDGLKKHIKEHHEDMRERPCPHPGCNKVFMIDRYLQRHVKLI
HTEERNYICDQCGQTFKQRKHLSVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAE
EDLEFQCLMCSKRFEKAHNLNVHMSMVHPLTQA
Download sequence
Identical sequences H2MKD9
ENSORLP00000019150 8090.ENSORLP00000019150 ENSORLP00000019150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]