SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019163 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019163
Domain Number 1 Region: 48-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000516
Family HkH motif-containing C2H2 finger 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019163   Gene: ENSORLG00000015301   Transcript: ENSORLT00000019164
Sequence length 290
Comment pep:known chromosome:MEDAKA1:17:23175119:23178684:-1 gene:ENSORLG00000015301 transcript:ENSORLT00000019164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKESPAQPAPAKLKVEVKKFVKIGRPGYKVT
KQRDPEIGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYETIA
FKVPSREIDKAETRFWTHWNKETKQFFLQFHFKMEKAISQSGNLLPPGMKHPPPLMSGPR
QPGDNMPPPPGGMSVPPLPPGASGPPPMPHQMPMPPMPMRPPPPEGLTLS
Download sequence
Identical sequences H2MKF1
ENSORLP00000019163 XP_004079236.1.28442 XP_011485010.1.28442 8090.ENSORLP00000019163 ENSORLP00000019163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]