SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019218 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019218
Domain Number 1 Region: 331-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 51-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 107-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 163-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 372-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 12-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000023
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019218   Gene: ENSORLG00000015351   Transcript: ENSORLT00000019219
Sequence length 470
Comment pep:novel chromosome:MEDAKA1:5:27934774:27949628:1 gene:ENSORLG00000015351 transcript:ENSORLT00000019219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDENGPSSKVQKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERH
SLIHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTH
TGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVK
PYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYAC
TMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSLTHTGVKPYACTMCD
KRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSLTHTGVKPYACSMCDMRFI
QRNHLERHSLTHTGEKPFACDMCDMRFIQRYHLERHKRVHSGEKPYQCERCQQNFSRTDR
LLRHRRLCQGRSVAKVENQPCCDPRPYPQEPPPAPPTWSPLHPPPGRLAV
Download sequence
Identical sequences H2MKK3
ENSORLP00000019218 ENSORLP00000019218 8090.ENSORLP00000019218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]