SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019246 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019246
Domain Number 1 Region: 234-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000242
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 267-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000139
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019246   Gene: ENSORLG00000015374   Transcript: ENSORLT00000019247
Sequence length 305
Comment pep:novel chromosome:MEDAKA1:14:32330767:32342545:1 gene:ENSORLG00000015374 transcript:ENSORLT00000019247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTEPVDLSLNKPRSSSTANPSPGAAVMQPSLPATPVPSAVQSIGSMVTTVLSPGSILATQ
GAGGQQILHVIHTIPSVTMPSKVGQLQTIPVVVQSLPVVYTTVPPDSVATAAITVPLIGS
DGRSEGSALNLHNILWKNASAKKESKESLAQAELNDRKSKSLLLQSLLKITQTCLSSPET
DQTEEIAGHHPARDLTPPFQHAQTGGQIRYSLDLKRRRIHMCDYEGCKKVYTKSSHLKAH
RRIHTGEKPYHCTWEGCTWRFARSDELTRHFRKHTGIKPFRCTECDRSFSRSDHLSLHRR
RHVMM
Download sequence
Identical sequences H2MKM8
ENSORLP00000019246 8090.ENSORLP00000019246 ENSORLP00000019246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]