SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019309 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019309
Domain Number 1 Region: 12-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 86-128
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000824
Family Hairy Orange domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019309   Gene: ENSORLG00000015428   Transcript: ENSORLT00000019310
Sequence length 198
Comment pep:known chromosome:MEDAKA1:13:31773808:31775068:1 gene:ENSORLG00000015428 transcript:ENSORLT00000019310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASSVVQDVDKHPSAKEERKMRKPLIERKRRERINNCLDQLKETVIGAFRLDQSKLEKA
DILEMTVKHLQNIQNSQMPDPTLGLEAQQRYSTGYIQCMHEVHNMLLTCDWMDKTLGSRL
LNHLLKSLPRSTDDSSRNQPRHDALLDVPLRSVLATPLRGLPKKPRQKEGSPPLLGGQQE
RPELHSSHLSMMEMWRPW
Download sequence
Identical sequences H2MKT8
ENSORLP00000019309 ENSORLP00000019309 XP_004076005.1.28442 XP_020564194.1.28442 8090.ENSORLP00000019309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]