SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019320 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019320
Domain Number 1 Region: 96-140
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000353
Family Hairy Orange domain 0.0058
Further Details:      
 
Domain Number 2 Region: 31-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000122
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019320   Gene: ENSORLG00000015432   Transcript: ENSORLT00000019321
Sequence length 233
Comment pep:known chromosome:MEDAKA1:13:31779472:31781741:1 gene:ENSORLG00000015432 transcript:ENSORLT00000019321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSVQPSSSSSSSSDVCTEDDEPYGIQRADRKVRKPLVEKKRRARINESLQELRTLLAD
ADFNSKMENAEVLEVTVKKVEDILKSRSQEKDALNREASERFAAGYIQCMHEVHTFVTSC
PGIDAAVAAELLNHLLECMPLNEDHLQDVLMDLITDTSACNSSTLASPGGGSLSGCEASA
LSPATSPSSEDSCSDLDEVDGEHHQSSTEVAAGSRGGLSMPTVAYPRFMWRPW
Download sequence
Identical sequences H2MKU9
ENSORLP00000019320 8090.ENSORLP00000019320 ENSORLP00000019320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]