SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019354 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019354
Domain Number 1 Region: 1355-1622
Classification Level Classification E-value
Superfamily VPS9 domain 7.85e-36
Family VPS9 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 12-201
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.12e-35
Family Regulator of chromosome condensation RCC1 0.01
Further Details:      
 
Domain Number 3 Region: 507-669
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.5e-26
Family Regulator of chromosome condensation RCC1 0.029
Further Details:      
 
Domain Number 4 Region: 1025-1114
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.63e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0079
Further Details:      
 
Domain Number 5 Region: 1119-1227
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.48e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 
Domain Number 6 Region: 891-992
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000108
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 7 Region: 677-880
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000752
Family DBL homology domain (DH-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019354   Gene: ENSORLG00000015458   Transcript: ENSORLT00000019355
Sequence length 1625
Comment pep:novel chromosome:MEDAKA1:21:18933583:18955979:1 gene:ENSORLG00000015458 transcript:ENSORLT00000019355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQGQVHVWRSAGSTEKLSPERALLSTSVVQVSLGDHHGLLLAQGGRVFSFGELPWRALSV
PLSAPVLEASLLGKAVTFVAAGGFHCGALSEQGSVFMWGENASGQCEVVIVLTVPEPSLV
SVVDTEVIPPKVVQVIQLACGREHSLALSAQNELWAWGSGCQLGLVTSTFPVKKPQKVEH
LAGRHVIQVACGAYHSLALVRTLPPQVYKTQNSPKMRERGPSPHRPMSDREELLSSDDAH
YCPLGVELNQAQKQLAASDALPIIASIKRRFAAVLQTVIMTFQVLLDHLRNFSFLLLQED
KSRSRSLILGESRLTRNVSIGSWPESEGCADSGFQTDSSPRAQQLWMSDKNFPVEELESQ
HTAQTGETDSLSSHTSVCSSGAQKTVVFFEVGALIMVLVLNKKSCLNWLIFDLVFRSSIG
LSGLYSSSPLCLEEIHLSLQSLKSSSLTNIHEKGSSAASRRRSLPGTPTHGSPQRHRLCA
CRPLSGGRVQAAASEAAGDGLPSLETEVWSWGRGSEGQLGHGDQLARLQPLCVKSLTGQE
VIKVAAGSHHSLALTAHCRVYSWGSNISGQLGHVNIPVTVPQQIKLSDGLHVWDLSGGQS
HSLLLADSDCVQPVLLYCGQQQQPLPVKTAMLRSLSSCQRSPNRAESYTMGYISSVRSGG
QMCAVLMNHNIRGFTSAIHELASKERRLYCWLISVGRLLLFRLRDRQSVSLLLGEQCTQL
FSTLCETFVRLSALAGRHSTSLNYFLHSGHIRDVTSLSLLTHTEFFQDTYKKYCSAVDDF
QVMGGFQSLHNLSVECLATQQTTLAQLCGSNQSVGGEVDLGSVFYWPLQQLHQYHRTLLR
LTACYDVSTIEYQSLNQGCAQYESLSLSLLKQKKEAETTFLFWKTHCGKATEGLRLPQRR
VVCESSNRSLTPQNAGRFSSHWFILFNDVLVHAQFSIHRIYHLSWLWVKPITEDDTGLCA
IKITCPEEVFTLVASSPQEKNKWLRSLNQAVDRALGGSGERSPGPAAMSRMASYTFAADE
RLRDAQYTGGWLAGRLHGSGTLKWPDGRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQG
QWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTG
YGVFDDITRGQKYMGLWLDDQRHGNAIVISQHGVYFEGTFRENKMSGPGLLVSEDETTFH
GEFSDDWTVSGKGVLFLANGDSLDGMFSGEWSSGLKVVGLYTRPATSESESKEKQTPKLG
QYVVPATQRWSCIFDECWSRLGCDAAGRGDRATAWGNIAVTITTARRQRKQHSPNVSKSQ
SKLLESLEFIPQYAEPVTTANYDRIRRYLCKACETPYHPLGWLVETLVTAYRMTYVGSDR
RLLQQAVAEVKVYLTHFYSIVRFLFSGLQEDGSVLPEPASHSSNSRSNSMNEWQSVLVVS
CSSLLLPLLLPRLYPPLFELYCQQEEQEEAQYWQRIITFNKQPDQSLLSFLEVQEKFWPH
WMLILGEKKQIVSSSKDACFVSAVETLQQISTTFTPGDKLLVIQETFKELKAEANLSLHR
DVLWCMDDLLPLFMYVVIRARIRNLKAEVSLIEDLMDPNIQHGEMGLMFTTLQACYFQIQ
KESMT
Download sequence
Identical sequences H2MKY3
8090.ENSORLP00000019354 ENSORLP00000019354 ENSORLP00000019354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]