SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019364 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019364
Domain Number 1 Region: 727-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000885
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 642-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000206
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 240-263,610-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000763
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019364
Domain Number - Region: 133-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00039
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019364   Gene: ENSORLG00000015469   Transcript: ENSORLT00000019365
Sequence length 926
Comment pep:novel chromosome:MEDAKA1:3:35229944:35242139:-1 gene:ENSORLG00000015469 transcript:ENSORLT00000019365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THSSSSAASSSPVLGSRSQRRQQEAKEAPRHFQLRQADDSLIQVIEKLSKIVEKQPHRRG
TLGGQKRVLHVATSAGGGAVEEASACKKVKRHCPEEARKAGGHDGALSSPASGDDSNNNS
VATGGAQRRTVTCYQCSLCPFLSQTLPQLKEHLKQHNEQHSDLILMCSECHFASRDQAQL
EAHVRLHFDEGGDTRGSSAPSDLEGKEDVDGGRSRLHGEGVQGSVESSRKSWYKFEEYGL
YRCLICSYVCTQQRMLKTHAWKHAGLVDCSYPIFEEEDGGSAKKEVQVPANSVAPRLQLC
VPLTVENKEDTLNLTVPGLSQSPKAAKGEEDSEYPKDMGSEEPAVEVQVTTEAEAELELD
GRRGGSSVPDSLLSSAQKIINSSPNSVGHINVIVERLPSAEDSLLVTKPLLLGPDMDRDK
GLLAAKQGEQDYAADVAADSQPAGGDVKPPGIKSSDSSRDENIPPAGRKRTHSESLRLHS
LAAEALVAMPMRMPELPASGAKVNLTPCAGHKLLEAGKKASDKGSAAALLNLELGSEEDL
CPLAGGDDESPSTKAGISMSLLTVIERLRERSDQNASDEDILKELRDNAQFIPGGDGLPP
DGGLVDYVPGSERPYRCRLCRYSSCNKGYIKQHLRVHKQRPPYQCPICEHKASNSKDLEN
HMIHHCKTRTYQCKQCPDSFYYKSQLRSHEREHLSVGGDVPALTAVAEAVASVEDADMGT
DEEGNAQKMFKCDVCNYTSSTYVGVRNHRRIHNSDKPYRCSLCGYVCSHPPSLKSHMWKH
AGDQNYNYEQVNKAINEAISQSSRTSNKTNIKTQTRLDVLCCDVFEEKLQTALGPHDLLI
GETCRQLLGISDSKYLQNSEETTSQIPHFPSAFAPSMEYCVLLFCCCICGFESTSKERLM
EHMKEHEGAIISIILNKEQQQAETQA
Download sequence
Identical sequences H2MKZ3
ENSORLP00000019364 8090.ENSORLP00000019364 ENSORLP00000019364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]