SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019398 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019398
Domain Number 1 Region: 134-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 359-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000164
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 792-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000011
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 655-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000215
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019398
Domain Number - Region: 287-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000264
Family Classic zinc finger, C2H2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019398   Gene: ENSORLG00000015493   Transcript: ENSORLT00000019399
Sequence length 1380
Comment pep:novel chromosome:MEDAKA1:3:35827698:35873203:-1 gene:ENSORLG00000015493 transcript:ENSORLT00000019399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSSLCLGVSSAVPDADVHLSSAVLNGRYPISQKLHQLTAQLGHAFPELHRPQQLPEEK
AATPLDEKSHHAALASQPISSQMALLANQLNRNIDAGALSGLNGRVDLQQFLNGQNLGIM
SQMNDIEDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLK
IHLRTHKLGNLGKGRGRVREENRLLHELEERAILRDKQMRGSGSLLQTAQTLGLNSNSNT
HPQQIGSACGPPPPPTLATPETLCQPSTSPKPTGAQDEQSVNPSTGFRCTFCKGKFKKRE
ELDRHIRILHKPYKCTLCEFAASHEEELISHVEKAHITAETTQGQGPGGAGGMQMATEFR
CDVCGQVFSQAWFLKGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLAIKSKPP
QHSEQDMAAINSMSSLAQEAHANLYSRYISCLQGGFLSPDKQGLSEQHQMLAKAGIVMKE
KEMLGKLLGPMAGGVAHGLGENEKRSLLGCLNLVPPLKSSCMERLQAAAKVAEMDSLNSY
QAWQIMARGMEMERAFLPKDQQHPPHVTPGQDDETGGALASYSKDKQDYSLIASSDSSKQ
KQLSDALQASKASGGAMMPMKEDGRSFESHRDLLLHHAGLGGPNVDYGLSSLSGLKEKPS
ECPDCGRAFRTYHQMVVHSRIHSRDGRGIDEALHQGAEERRGSASDPESQSISRSTTPGS
SNVTEESGAGGGQSQTGSVQDDSPHPSSPSSVDLGPKAVFPMCTGFDPPSSSASSSSSQS
RLKHLKSDGKGFVASHKIKYHSAIYSGEKPYRCPHCDYAGTQSASLKYHLERHHRERQNG
STPSGAASAHNASSDHKDEHGKAGGGGFARPDVLRNVFKGVPHGLDFRGGPLLPPQWAGM
MSSHDRDRSERRFDTSAEKTADGPIIAPDSAPSFSDLSRAYQSMMGNGVHLQGSLQAFMD
NFVLSSMKKDLKDSQGAAQLQAQRYHDNGEPKAKRATPNDLEREDKADTKSSSEPGKPGS
QYEPLDLSVSVRPESASGSLPGSSVTIHDNVAWHGCLFCSFSTSSLELMALHLQANHLGK
AQLPRPDAGKEIQREGSPTTSAVHPSKTSALALDREADRDGEKQQGAWNNRLDQPYNPFQ
SDFYKRFGGLYDESPRANQGLQGYIGQAEQGLEQPAQTFGGSSLGGEEQIGERGSCGDVE
DEQTGSDEEAGKPGEHGAIGIPLASQPLQNHSDGEEEDPGMDDEEDDRDDEEQMDMDGEK
EESPASELLHTHANQLHEDPSLHSRGRVGLAASSSAMPPLSLHPQNQTLPLEKSWQAGLG
LLSPGGPPGLMKSDQHLEQQMNMLSVLRAYSNDSLPPFNGLGVGGAASGGVKRSEAPGEF
Download sequence
Identical sequences H2ML27
ENSORLP00000019398 8090.ENSORLP00000019398 ENSORLP00000019398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]