SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019577 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019577
Domain Number 1 Region: 270-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-20
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 232-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000217
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 314-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000049
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019577   Gene: ENSORLG00000015640   Transcript: ENSORLT00000019578
Sequence length 351
Comment pep:novel chromosome:MEDAKA1:22:11568108:11570465:1 gene:ENSORLG00000015640 transcript:ENSORLT00000019578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIMASGDTLYIETDGSEMPAEIVELHEIEVETIETTIVGDDGEHQPMIALQPLDTDDPNA
IHSHQEVILVQTREEVVGEEDSELPADDGFEDQILIPVPAVEEDYIEQTLVTIAGKSSTG
RMKKSASGKKAGKKSYLTGGEMGRKWEQKQVQIKTLEGEFSVTMWASDDKKDMDHGEQIT
GENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGC
TKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKR
FSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Download sequence
Identical sequences H2MLJ8
ENSORLP00000019577 8090.ENSORLP00000019577 ENSORLP00000019577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]