SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019601 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019601
Domain Number 1 Region: 52-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000118
Family CHHC finger 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019601   Gene: ENSORLG00000015654   Transcript: ENSORLT00000019602
Sequence length 309
Comment pep:novel chromosome:MEDAKA1:16:24090004:24094633:1 gene:ENSORLG00000015654 transcript:ENSORLT00000019602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSFQPKTDEDRLKCLQELTEFTEKCKKQLHDIFETLGWSPDYRTSNQEPLEQCPYDPD
HRVPAKSMEKHKTSCSLRKMGYSAEEQAEMYDPSVCYENSSVRSLTMDKATQHQVILQAR
SAAPLMKMEGVFWQGQYSGEAVDVPQNHKRAVCDLTVADRLALYDHVIGALGQQKEGNKD
DLYVDLVSKLQKDDKQNEPKSHLELIAEMRDYKRRRQSYRAKNVHITKKSYTEVIREVIS
VHSEELARQWKEEEEEESQRSEPSCHSRRLDQRRSASTESRHSHGRRHRSRERSPDRESK
KKKKKRKER
Download sequence
Identical sequences H2MLM2
ENSORLP00000019601 8090.ENSORLP00000019601 ENSORLP00000019601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]